SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP49151_P050-HRP
Price: $434.00
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

NAT8L Antibody - C-terminal region : HRP (ARP49151_P050-HRP)

Datasheets/ManualsPrintable datasheet for anti-NAT8L (ARP49151_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ConjugationHRP: Horseradish Peroxidase
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 89%
Peptide SequenceSynthetic peptide located within the following region: VAAHKLYESLGFRHMGASDHYVLPGMTLSLAERLFFQVRYHRYRLQLREE
Concentration0.5 mg/ml
Blocking PeptideFor anti-NAT8L (ARP49151_P050-HRP) antibody is Catalog # AAP49151
Gene SymbolNAT8L
Gene Full NameN-acetyltransferase 8-like (GCN5-related, putative)
Alias SymbolsCML3, NACED, NAT8-LIKE
NCBI Gene Id339983
Protein NameN-acetylaspartate synthetase
Description of TargetThis gene encodes a single-pass membrane protein, which contains a conserved sequence of the GCN5 or NAT superfamily of N-acetyltransferases and is a member of the N-acyltransferase (NAT) superfamily. This protein is a neuron-specific protein and is the N-acetylaspartate (NAA) biosynthetic enzyme, catalyzing the NAA synthesis from L-aspartate and acetyl-CoA. NAA is a major storage and transport form of acetyl coenzyme A specific to the nervous system. The gene mutation results in primary NAA deficiency (hypoacetylaspartia).
Uniprot IDQ8N9F0
Protein Accession #NP_848652
Nucleotide Accession #NM_178557
Protein Size (# AA)134
Molecular Weight15kDa
  1. What is the species homology for "NAT8L Antibody - C-terminal region : HRP (ARP49151_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "NAT8L Antibody - C-terminal region : HRP (ARP49151_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "NAT8L Antibody - C-terminal region : HRP (ARP49151_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact

  4. What are other names for "NAT8L Antibody - C-terminal region : HRP (ARP49151_P050-HRP)"?

    This target may also be called "CML3, NACED, NAT8-LIKE" in publications.

  5. What is the shipping cost for "NAT8L Antibody - C-terminal region : HRP (ARP49151_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "NAT8L Antibody - C-terminal region : HRP (ARP49151_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "NAT8L Antibody - C-terminal region : HRP (ARP49151_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "15kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "NAT8L Antibody - C-terminal region : HRP (ARP49151_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "NAT8L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "NAT8L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "NAT8L"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "NAT8L"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "NAT8L"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "NAT8L"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:NAT8L Antibody - C-terminal region : HRP (ARP49151_P050-HRP)
Your Rating
We found other products you might like!