NAPSA Antibody - C-terminal region (ARP64546_P050)

Catalog No: ARP64546_P050

WB Suggested Anti-NAPSA Antibody
Titration: 1.0 ug/ml
Positive Control: THP-1 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: PAGPFWILGDVFLGTYVAVFDRGDMKSSARVGLARARTRGADLGWGETAQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NAPSA (ARP64546_P050) antibody is Catalog # AAP64546

Target Info

• Gene Symbol: NAPSA
• Gene Full Name: Napsin A aspartic peptidase
• Alias Symbols: KAP, Kdap, NAP1, NAPA, SNAPA
• NCBI Gene Id: 9476
• Protein Name: Napsin-A
• Description of Target: The activation peptides of aspartic proteinases plays role as inhibitors of the active site. These peptide segments, or pro-parts, are deemed important for correct folding, targeting, and control of the activation of aspartic proteinase zymogens. The pronapsin A gene is expressed predominantly in lung and kidney. Its translation product is predicted to be a fully functional, glycosylated aspartic proteinase precursor containing an RGD motif and an additional 18 residues at its C-terminus.
• Uniprot ID: O96009
• Protein Accession #: NP_004842
• Nucleotide Accession #: NM_004851
• Protein Size (# AA): 420
• Molecular Weight: 39kDa
• Protein Interactions: UBC;