NAPG Recombinant Protein (Human) (OPCA04885)

Catalog No: OPCA04885

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Homo sapiens (Human)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENDERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC
• Protein Sequence: MAAQKINEGLEHLAKAEKYLKTGFLKWKPDYDSAASEYGKAAVAFKNAKQFEQAKDACLREAVAHENNRALFHAAKAYEQAGMMLKEMQKLPEAVQLIEKASMMYLENGTPDTAAMALERAGKLIENVDPEKAVQLYQQTANVFENDERLRQAVELLGKASRLLVRGRRFDEAALSIQKEKNIYKEIENYPTCYKKTIAQVLVHLHRNDYVAAERCVRESYSIPGFNGSEDCAALEQLLEGYDQQDQDQVSDVCNSPLFKYMDNDYAKLGLSLVVPGGGIKKKSPATPQAKPDGVTATAADEEEDEYSGGLC
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-312 aa
• Tag: N-terminal GST-tagged
• Reference: Regulated secretion in platelets: identification of elements of the platelet exocytosis machinery. Lemons P.P., Chen D., Bernstein A.M., Bennett M.K., Whiteheart S.W. Blood 90:1490-1500(1997)

Target Info

• Gene Symbol: NAPG
• Gene Full Name: NSF attachment protein gamma
• Alias Symbols: GAMMASNAP;gamma-soluble NSF attachment protein;N-ethylmaleimide-sensitive factor attachment protein gamma;N-ethylmaleimide-sensitive factor attachment protein, gamma;SNAP-gamma;soluble NSF attachment protein.
• NCBI Gene Id: 8774
• Protein Name: Gamma-soluble NSF attachment protein
• Description of Target: Required for vesicular transport between the endoplasmic reticulum and the Golgi apparatus.
• Uniprot ID: Q99747
• Protein Accession #: NP_003817
• Nucleotide Accession #: NM_003826
• Protein Size (# AA): Recombinant
• Molecular Weight: 61.7 kDa