NANOG Antibody - N-terminal region : HRP (P100728_P050-HRP)

Catalog No: P100728_P050-HRP

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: HRP: Horseradish Peroxidase
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human NANOG
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: YPSLQMSSAEMPHTETVSPLPSSMDLLIQDSPDSSTSPKGKQPTSAEKSV
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NANOG (P100728_P050-HRP) antibody is Catalog # AAP31012 (Previous Catalog # AAPP01745)
• Sample Type Confirmation:

  NANOG is supported by BioGPS gene expression data to be expressed in OVCAR3

• Reference: Go,M.J., (2008) Exp. Cell Res. 314 (5), 1147-1154

Target Info

• Gene Symbol: NANOG
• Gene Full Name: Nanog homeobox
• Alias Symbols: -
• NCBI Gene Id: 79923
• Protein Name: Homeobox protein NANOG
• Description of Target: NANOG is a new marker for testicular carcinoma in situ and germ cell tumors. Gene knockdown of Nanog promotes differentiation, thereby demonstrating a role for these factors in human embryonic stem cell self-renewal.
• Uniprot ID: Q9H9S0
• Protein Accession #: NP_079141
• Nucleotide Accession #: NM_024865
• Protein Size (# AA): 305
• Molecular Weight: 34kDa
• Protein Interactions: DOT1L; UBC; ZNF281; RHOXF2; SALL4; MED12;