NANOG Antibody - middle region (ARP30891_P050)

Catalog No: ARP30891_P050

WB Suggested Anti-NANOG Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:62500
Positive Control: Jurkat cell lysate

Product Info

• Publications:

  Kallas, A., Pook, M., Maimets, M., Zimmermann, K. & Maimets, T. Nocodazole treatment decreases expression of pluripotency markers Nanog and Oct4 in human embryonic stem cells. PLoS One 6, e19114 (2011). 21559451

  Maimets, T., Neganova, I., Armstrong, L. & Lako, M. Activation of p53 by nutlin leads to rapid differentiation of human embryonic stem cells. Oncogene 27, 5277-87 (2008). 18521083

  Neganova, I., Zhang, X., Atkinson, S. & Lako, M. Expression and functional analysis of G1 to S regulatory components reveals an important role for CDK2 in cell cycle regulation in human embryonic stem cells. Oncogene 28, 20-30 (2009). 18806832

  More...

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human NANOG
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 93%; Goat: 86%; Guinea Pig: 92%; Horse: 93%; Human: 100%; Mouse: 92%; Rabbit: 86%; Rat: 92%; Sheep: 86%
• Peptide Sequence: Synthetic peptide located within the following region: SYKQVKTWFQNQRMKSKRWQKNNWPKNSNGVTQKASAPTYPSLYSSYHQG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-NANOG (ARP30891_P050) antibody is Catalog # AAPP47296

Target Info

• Gene Symbol: NANOG
• Gene Full Name: Nanog homeobox
• Alias Symbols: -
• NCBI Gene Id: 79923
• Protein Name: Putative homeobox protein NANOGP8
• Description of Target: NANOG is a new marker for testicular carcinoma in situ and germ cell tumors. Gene knockdown of Nanog promotes differentiation, thereby demonstrating a role for these factors in human embryonic stem cell self-renewal.
• Uniprot ID: Q6NSW7
• Protein Accession #: NP_079141
• Nucleotide Accession #: NM_024865
• Protein Size (# AA): 305
• Molecular Weight: 34kDa
• Protein Interactions: DOT1L; UBC; ZNF281; RHOXF2; SALL4; MED12;