NAGA Antibody - N-terminal region (ARP63321_P050)

Catalog No: ARP63321_P050

WB Suggested Anti-NAGA Antibody
Titration: 1.0 ug/ml
Positive Control: MCF7 Whole Cell

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Dog, Horse, Pig, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N-terminal region of NAGA
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Dog: 79%; Horse: 86%; Human: 100%; Mouse: 93%; Pig: 86%; Rabbit: 79%; Rat: 86%
• Peptide Sequence: Synthetic peptide located within the following region: GYTYLNIDDCWIGGRDASGRLMPDPKRFPHGIPFLADYVHSLGLKLGIYA
• Concentration: 0.5 mg/ml
• Blocking Peptide: Available upon request

Target Info

• Gene Symbol: NAGA
• Alias Symbols: GALB, D22S674
• NCBI Gene Id: 4668
• Protein Name: Alpha-N-acetylgalactosaminidase
• Description of Target: NAGA encodes the lysosomal enzyme alpha-N-acetylgalactosaminidase, which cleaves alpha-N-acetylgalactosaminyl moieties from glycoconjugates. Mutations in NAGA have been identified as the cause of Schindler disease types I and II (type II also known as Kanzaki disease).
• Uniprot ID: P17050
• Protein Accession #: NP_000253
• Nucleotide Accession #: NM_000262
• Protein Size (# AA): 411
• Molecular Weight: 45kDa
• Protein Interactions: APP; FBXO6; UBC; GNGT1;