N16.1 Recombinant Protein (Akoya pearl oyster) (OPCA02484)

Catalog No: OPCA02484

N16.1 Recombinant Protein (Pinctada fucata) (OPCA02484) in SDS-PAGE showing the molecular weight of approximately 28.9 kDa.

Product Info

• Predicted Species Reactivity: Pinctada fucata
• Product Format: Liquid or Lyophilized powder
• Host: Pinctada fucata
• Additional Information: Relevance: May be specifically involved in the formation of the nacreous layer.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: AYHKKCGRYSYCWIPYDIERDRRDNGGKKYCFCRYAWSPWQCNEEERYEWLRCGMRFYSLCCYTDDDNGNGNGNGNGNGLNYLKSLYGGYGNGNGEFREEYIDERYDN
• Protein Sequence: AYHKKCGRYSYCWIPYDIERDRRDNGGKKYCFCRYAWSPWQCNEEERYEWLRCGMRFYSLCCYTDDDNGNGNGNGNGNGLNYLKSLYGGYGNGNGEFREEYIDERYDN
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 24-131 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: An acidic matrix protein, Pif, is a key macromolecule for nacre formation.Suzuki M., Saruwatari K., Kogure T., Yamamoto Y., Nishimura T., Kato T., Nagasawa H.Science 325:1388-1390(2009)
• Alias Symbols: N14#1.
• Protein Name: N16.1 matrix protein
• Description of Target: May be specifically involved in the formation of the nacreous layer.
• Uniprot ID: Q9TVT2
• Protein Size (# AA): Recombinant
• Molecular Weight: 28.9 kDa