Protein on Demand™ N Recombinant Protein (HCoV-OC43) (OPCA55632)

Catalog No: OPCA55632

Product Info

• Predicted Species Reactivity: Human coronavirus OC43
• Product Format: Lyophilized powder
• Application: WB, ELISA
• Additional Information: For Research Use Only.
  Sterile filtering available upon request.
  Low endotoxin available upon request.
• Reconstitution and Storage: We recommend that this vial be briefly centrifuged prior to opening to bring the contents to the bottom. Please reconstitute protein in deionized sterile water to a concentration of 0.1-1.0 mg/mL.We recommend to add 5-50% of glycerol (final concentration) and aliquot for long-term storage at -20C/-80C. Our default final concentration of glycerol is 50%. Customers could use it as reference.
• Purification: Affinity purified using IMAC
• Concentration: Varies by lot. See vial for concentration.
• Purity: Greater than 85% as determined by SDS-PAGE.
• Protein Sequence: MSFTPGKQSSSRASSGNRSGNGILKWADQSDQVRNVQTRGRRAQPKQTATSQQPSGGNVVPYYSWFSGITQFQKGKEFEFVEGQGPPIAPGVPATEAKGYWYRHNRGSFKTADGNQRQLLPRWYFYYLGTGPHAKDQYGTDIDGVYWVASNQADVNTPADIVDRDPSSDEAIPTRFPPGTVLPQGYYIEGSGRSAPNSRSTSRTSSRASSAGSRSRANSGNRTPTSGVTPDMADQIASLVLAKLGKDATKPQQVTKHTAKEVRQKILNKPRQKRSPNKQCTVQQCFGKRGPNQNFGGGEMLKLGTSDPQFPILAELAPTAGAFFFGSRLELAKVQNLSGNPDEPQKDVYELRYNGAIRFDSTLSGFETIMKVLNENLNAYQQQDGMMNMSPKPQRQRGHKNGQGENDNISVAVPKSRVQQNKSRELTAEDISLLKKMDEPYTEDTSEI
• Storage Buffer: Lyophilized from Tris/PBS-based buffer, 6% Trehalose, pH 8.0
• Protein Range: 1-448 aa
• Tag: This protein may contain a N-terminal tag or C-terminal tag based on protein stability requirements.

Target Info

• Gene Symbol: N
• NCBI Gene Id: 2648210
• Protein Name: nucleocapsid protein
• Description of Target: Packages the positive strand viral genome RNA into a helical ribonucleocapsid (RNP) and plays a fundamental role during virion assembly through its interactions with the viral genome and membrane protein M. Plays an important role in enhancing the efficiency of subgenomic viral RNA transcription as well as viral replication.
• Uniprot ID: P33469
• Protein Size (# AA): 448
• Molecular Weight: 55.3 kDa