Search Antibody, Protein, and ELISA Kit Solutions

MYOZ1 Antibody - middle region (ARP88448_P050)

100 ul
In Stock
Request Bulk Order Quote

Gene Symbol:
Official Gene Full Name:
myozenin 1
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
Description of Target:
The protein encoded by this gene is primarily expressed in the skeletal muscle, and belongs to the myozenin family. Members of this family function as calcineurin-interacting proteins that help tether calcineurin to the sarcomere of cardiac and skeletal muscle. They play an important role in modulation of calcineurin signaling.
Protein Size (# AA):
Molecular Weight:
32 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MYOZ1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MYOZ1.
The immunogen is a synthetic peptide directed towards the middle region of human MYOZ1
Predicted Species Reactivity:
Tested Species Reactivity:
Peptide Sequence:
Synthetic peptide located within the following region: DVFSDSSMDHFQKFLPTVGGQLGTAGQGFSYSKSNGRGGSQAGGSGSAGQ
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MYOZ1 (ARP88448_P050) antibody is Catalog # AAP88448
Printable datasheet for anti-MYOZ1 (ARP88448_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...