Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP64209_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP64209_P050-FITC Conjugated

ARP64209_P050-HRP Conjugated

ARP64209_P050-Biotin Conjugated

MYO10 Antibody - C-terminal region (ARP64209_P050)

Catalog#: ARP64209_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 86%; Guinea Pig: 93%; Horse: 79%; Human: 100%; Mouse: 93%; Rabbit: 92%; Rat: 93%
Complete computational species homology data Anti-MYO10 (ARP64209_P050)
Peptide Sequence Synthetic peptide located within the following region: TYKIVVDERELLFETSEVVDVAKLMKAYISMIVKKRYSTTRSASSQGSSR
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MYO10 (ARP64209_P050) antibody is Catalog # AAP64209
Datasheets/Manuals Printable datasheet for anti-MYO10 (ARP64209_P050) antibody
Gene Symbol MYO10
Official Gene Full Name Myosin X
Alias Symbols -
NCBI Gene Id 4651
Protein Name cDNA FLJ90236 fis, clone NT2RM2000589, moderately similar to Bos taurus myosin X EMBL BAC11158.1
Description of Target This gene encodes a member of the myosin superfamily. The protein represents an unconventional myosin; it should not be confused with the conventional non-muscle myosin-10 (MYH10). Unconventional myosins contain the basic domains of conventional myosins and are further distinguished from class members by their tail domains. This gene functions as an actin-based molecular motor and plays a role in integration of F-actin and microtubule cytoskeletons during meiosis.
Swissprot Id Q8NCI3
Protein Accession # BAC11158
Nucleotide Accession # NM_012334
Protein Size (# AA) 984
Molecular Weight 110kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MYO10.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MYO10.
Protein Interactions UBC; PAN2; CAND1; KIAA0368; PRKCI; TERF2; FBXW11; PLA2G10; DYNLL1; ITGB5; CALML3; CALM1; ACTA1; CALM3; ITGB1; ITGB3;
Write Your Own Review
You're reviewing:MYO10 Antibody - C-terminal region (ARP64209_P050)
Your Rating