MYL6 Recombinant Protein (Human) (OPCA00571)

Catalog No: OPCA00571

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Additional Information: Tag information : GST tag
  
• Reconstitution and Storage: -20°C or -80°C
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
• Protein Sequence: DFTEDQTAEFKEAFQLFDRTGDGKILYSQCGDVMRALGQNPTNAEVLKVLGNPKSDEMNVKVLDFEHFLPMLQTVAKNKDQGTYEDYVEGLRVFDKEGNGTVMGAEIRHVLVTLGEKMTEEEVEMLVAGHEDSNGCINYEAFVRHILSG
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 3-151 aa
• Tag: N-terminal GST-tagged
• Reference: The alkali light chains of human smooth and nonmuscle myosins are encoded by a single gene. Tissue-specific expression by alternative splicing pathways.Lenz S., Lohse P., Seidel U., Arnold H.H.J. Biol. Chem. 264:9009-9015(1989)

Target Info

• Gene Symbol: MYL6
• Gene Full Name: myosin light chain 6
• Alias Symbols: 17 kDa myosin light chain;ESMLC;LC17;LC17A;LC17B;LC17-GI;LC17-NM;MLC1SM;MLC-3;MLC3NM;MLC3SM;Myosin light chain 3;myosin light chain A3;myosin light chain alkali 3;myosin light polypeptide 6;myosin, light chain 6, alkali, smooth muscle and non-muscle;myosin, light polypeptide 6, alkali, smooth muscle and non-muscle;Smooth muscle and nonmuscle myosin light chain alkali 6.
• NCBI Gene Id: 4637
• Protein Name: Myosin light polypeptide 6
• Description of Target: Regulatory light chain of myosin. Does not bind calcium.
• Uniprot ID: P60660
• Protein Size (# AA): Recombinant
• Molecular Weight: 43.7 kDa