SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP56153_P050
Price: $0.00
SKU
ARP56153_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MYL4 (ARP56153_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Cow, Dog, Horse, Pig
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MYL4
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 79%; Dog: 93%; Horse: 77%; Human: 100%; Pig: 83%
Peptide SequenceSynthetic peptide located within the following region: MAPKKPEPKKEAAKPAPAPAPAPAPAPAPAPEAPKEPAFDPKSVKIDFTA
Concentration0.5 mg/ml
Blocking PeptideFor anti-MYL4 (ARP56153_P050) antibody is Catalog # AAP56153 (Previous Catalog # AAPP37926)
Gene SymbolMYL4
Gene Full NameMyosin, light chain 4, alkali; atrial, embryonic
Alias SymbolsGT1, ALC1, AMLC, PRO1957
NCBI Gene Id4635
Protein NameMyosin light chain 4
Description of TargetMyosin is a hexameric ATPase cellular motor protein. It is composed of two myosin heavy chains, two nonphosphorylatable myosin alkali light chains, and two phosphorylatable myosin regulatory light chains. This gene encodes a myosin alkali light chain that is found in embryonic muscle and adult atria. Two alternatively spliced transcript variants encoding the same protein have been found for this gene.
Uniprot IDP12829
Protein Accession #NP_001002841
Nucleotide Accession #NM_001002841
Protein Size (# AA)197
Molecular Weight21kDa
Protein InteractionsPYROXD2; VCAM1; ITGA4; FN1; ALB; UBC;
  1. What is the species homology for "MYL4 Antibody - N-terminal region (ARP56153_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Cow, Dog, Horse, Pig".

  2. How long will it take to receive "MYL4 Antibody - N-terminal region (ARP56153_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MYL4 Antibody - N-terminal region (ARP56153_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MYL4 Antibody - N-terminal region (ARP56153_P050)"?

    This target may also be called "GT1, ALC1, AMLC, PRO1957" in publications.

  5. What is the shipping cost for "MYL4 Antibody - N-terminal region (ARP56153_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MYL4 Antibody - N-terminal region (ARP56153_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MYL4 Antibody - N-terminal region (ARP56153_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "21kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MYL4 Antibody - N-terminal region (ARP56153_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MYL4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MYL4"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MYL4"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MYL4"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MYL4"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MYL4"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MYL4 Antibody - N-terminal region (ARP56153_P050)
Your Rating
We found other products you might like!