Catalog No: OPCA312748
Price: $0.00
SKU
OPCA312748
Availability: Domestic: within 4-8 weeks delivery International: 4-8 weeks
Contact Us:
- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
Shipping Info:
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Protein on Demand™ MYDGF Recombinant Protein (Human) (OPCA312748)
Datasheets/Manuals | Printable datasheet for OPCA312748 |
---|
Predicted Species Reactivity | Human |
---|---|
Product Format | Liquid |
Application | WB, ELISA |
Additional Information | For Research Use Only. Sterile filtering available upon request. Low endotoxin available upon request. |
Reconstitution and Storage | The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week. |
Purity | Greater than 85% as determined by SDS-PAGE. |
Protein Sequence | VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL |
Storage Buffer | Tris-based buffer,50% glycerol |
Protein Range | 32-173 |
Gene Full Name | myeloid derived growth factor |
---|---|
Alias Symbols | IL25, IL27, SF20, IL27w, C19orf10, R33729_1, EUROIMAGE1875335 |
NCBI Gene Id | 56005 |
Protein Name | myeloid-derived growth factor |
Description of Target | The protein encoded by this gene was previously thought to support proliferation of lymphoid cells and was considered an interleukin. However, this activity has not been reproducible and the function of this protein is currently unknown. |
Uniprot ID | Q969H8 |
Protein Accession # | NP_061980.1 |
Nucleotide Accession # | NM_019107.3 |
Protein Size (# AA) | 142 |
Write Your Own Review