Search Antibody, Protein, and ELISA Kit Solutions

MYD88 Antibody - middle region (ARP56353_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56353_P050-FITC Conjugated

ARP56353_P050-HRP Conjugated

ARP56353_P050-Biotin Conjugated

Gene Symbol:
MYD88
Official Gene Full Name:
Myeloid differentiation primary response gene (88)
NCBI Gene Id:
4615
Protein Name:
Myeloid differentiation primary response protein MyD88
Swissprot Id:
Q99836
Protein Accession #:
NP_002459
Nucleotide Accession #:
NM_002468
Alias Symbols:
MYD88D
Replacement Item:
This antibody may replace item sc-11356 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a cytosolic adapter protein that plays a central role in the innate and adaptive immune response. This protein functions as an essential signal transducer in the interleukin-1 and Toll-like receptor signaling pathways. These pathways reg
Protein Size (# AA):
296
Molecular Weight:
33kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MYD88.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MYD88.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MYD88
Predicted Species Reactivity:
Cow, Dog, Goat, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep, Zebrafish
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Goat: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 79%
Complete computational species homology data:
Anti-MYD88 (ARP56353_P050)
Peptide Sequence:
Synthetic peptide located within the following region: TCVWSIASELIEKRCRRMVVVVSDDYLQSKECDFQTKFALSLSPGAHQKR
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MYD88; IRAK4; IL1R1; IKBKG; SPOP; SYK; SASH1; TRAF6; SIAH2; SIAH1; PFKL; PRDX1; MDM2; MAL; SMAD3; MBIP; TLR7; TNFRSF13B; CD93; IKBKE; POLR1C; IL1RL1; FADD; USP7; TXN; BST2; SMURF1; LRRFIP2; UBC; SMAD6; IRF5; IRAK1; BTK; PELI1; STAP2; TNIP1; TRAF3; IRAK2;
Blocking Peptide:
For anti-MYD88 (ARP56353_P050) antibody is Catalog # AAP56353 (Previous Catalog # AAPP38418)
Datasheets/Manuals:
Printable datasheet for anti-MYD88 (ARP56353_P050) antibody
Target Reference:
Dhiman,N., (2008) Vaccine 26 (14), 1731-1736

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...