Size:100 ul
Special Price $229.00 Regular Price $319.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31860_P050-FITC Conjugated

ARP31860_P050-HRP Conjugated

ARP31860_P050-Biotin Conjugated

MYCBP Antibody - middle region (ARP31860_P050)

Catalog#: ARP31860_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-102030 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MYCBP
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 92%; Dog: 92%; Guinea Pig: 100%; Horse: 92%; Human: 100%; Mouse: 92%; Rabbit: 92%; Rat: 100%
Complete computational species homology data Anti-MYCBP (ARP31860_P050)
Peptide Sequence Synthetic peptide located within the following region: AATPENPEIELLRLELAEMKEKYEAIVEENKKLKAKLAQYEPPQEEKRAE
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MYCBP (ARP31860_P050) antibody is Catalog # AAP31860 (Previous Catalog # AAPP02655)
Datasheets/Manuals Printable datasheet for anti-MYCBP (ARP31860_P050) antibody
Sample Type Confirmation

MYCBP is strongly supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference Furusawa,M., et al., (2002) J. Biol. Chem. 277 (52), 50885-50892

Cowell, J. K. & Hawthorn, L. The application of microarray technology to the analysis of the cancer genome. Curr. Mol. Med. 7, 103-20 (2007). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 17311536

Ramírez-Valle, F., Braunstein, S., Zavadil, J., Formenti, S. C. & Schneider, R. J. eIF4GI links nutrient sensing by mTOR to cell proliferation and inhibition of autophagy. J. Cell Biol. 181, 293-307 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 18426977

Gene Symbol MYCBP
Official Gene Full Name C-myc binding protein
Alias Symbols AMY-1
NCBI Gene Id 26292
Protein Name C-Myc-binding protein
Description of Target The MYCBP gene encodes a protein that binds to the N-terminal region of MYC and stimulates the activation of E box-dependent transcription by MYC.
Swissprot Id Q99417
Protein Accession # NP_036465
Nucleotide Accession # NM_012333
Protein Size (# AA) 103
Molecular Weight 12kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MYCBP.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MYCBP.
  1. What is the species homology for "MYCBP Antibody - middle region (ARP31860_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "MYCBP Antibody - middle region (ARP31860_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MYCBP Antibody - middle region (ARP31860_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "MYCBP Antibody - middle region (ARP31860_P050)"?

    This target may also be called "AMY-1" in publications.

  5. What is the shipping cost for "MYCBP Antibody - middle region (ARP31860_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MYCBP Antibody - middle region (ARP31860_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MYCBP Antibody - middle region (ARP31860_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "12kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MYCBP Antibody - middle region (ARP31860_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MYCBP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MYCBP"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MYCBP"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MYCBP"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MYCBP"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MYCBP"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MYCBP Antibody - middle region (ARP31860_P050)
Your Rating
We found other products you might like!