Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MYC antibody - N-terminal region : HRP (ARP30292_P050-HRP)

100 ul
$319.00
In Stock

Conjugation Options

ARP30292_P050 Unconjugated

ARP30292_P050-FITC Conjugated

ARP30292_P050-Biotin Conjugated

Gene Symbol:
MYC
NCBI Gene Id:
4609
Official Gene Full Name:
V-myc myelocytomatosis viral oncogene homolog (avian)
Protein Name:
Myc proto-oncogene protein
Swissprot Id:
P01106-2
Protein Accession #:
NP_002458
Nucleotide Accession #:
NM_002467
Alias Symbols:
c-Myc, MRTL, bHLHe39
Replacement Item:
This antibody may replace item sc-110502 from Santa Cruz Biotechnology.
Description of Target:
MYC is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this MYC gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma.The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene. The protein encoded by this gene is a multifunctional, nuclear phosphoprotein that plays a role in cell cycle progression, apoptosis and cellular transformation. It functions as a transcription factor that regulates transcription of specific target genes. Mutations, overexpression, rearrangement and translocation of this gene have been associated with a variety of hematopoietic tumors, leukemias and lymphomas, including Burkitt lymphoma. There is evidence to show that alternative translation initiations from an upstream, in-frame non-AUG (CUG) and a downstream AUG start site result in the production of two isoforms with distinct N-termini. The synthesis of non-AUG initiated protein is suppressed in Burkitt's lymphomas, suggesting its importance in the normal function of this gene. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Protein Size (# AA):
454
Molecular Weight:
50kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MYC.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MYC.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MYC
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Sheep, Zebrafish
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Sheep: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-MYC (ARP30292_P050)
Peptide Sequence:
Synthetic peptide located within the following region: QPYFYCDEEENFYQQQQQSELQPPAPSEDIWKKFELLPTPPLSPSRRSGL
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.6-0.7 mg/ml
Protein Interactions:
UBC; USP37; USP22; KDM1A; SKP2; SMAD7; SNRNP70; CEP57; LDOC1; BRD3; KIDINS220; MAX; CSNK2B; CSNK2A1; USP28; NMI; PFDN5; TP73; EP400; SP1; PIAS2; ZBTB17; IGF2BP3; PTRF; SDK1; MRPL53; PRKCDBP; PHLDB2; KNDC1; MZT2B; RIN3; NEK11; MICALL2; NLRX1; NABP2; MYC; M
Blocking Peptide:
For anti-MYC (ARP30292_P050-HRP) antibody is Catalog # AAP30292 (Previous Catalog # AAPS08702)
Datasheets/Manuals:
Printable datasheet for anti-MYC (ARP30292_P050-HRP) antibody
Sample Type Confirmation:

MYC is supported by BioGPS gene expression data to be expressed in HT1080

Conjugation:
HRP
Target Reference:
Zhu,J., (2008) Proc. Natl. Acad. Sci. U.S.A. 105 (18), 6584-6589
Publications:

Anti-MYCBP ARP30292_P050 has recently been referenced in the following publications:

Mallampalli, R. K. et al. Fbxl12 triggers G1 arrest by mediating degradation of calmodulin kinase I. Cell. Signal. 25, 2047–59 (2013). 23707388

Tell us what you think about this item!

Write A Review
    Please, wait...