Search Antibody, Protein, and ELISA Kit Solutions

MYBPH Antibody - N-terminal region (ARP56598_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP56598_P050-FITC Conjugated

ARP56598_P050-HRP Conjugated

ARP56598_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
MYBPH
Official Gene Full Name:
Myosin binding protein H
NCBI Gene Id:
4608
Protein Name:
Myosin-binding protein H
Swissprot Id:
Q13203
Protein Accession #:
NP_004988
Nucleotide Accession #:
NM_004997
Alias Symbols:
-
Replacement Item:
This antibody may replace item sc-165049 from Santa Cruz Biotechnology.
Description of Target:
MYBPH binds to myosin; probably involved in interaction with thick myofilaments in the A-band.
Protein Size (# AA):
477
Molecular Weight:
52kDa
Purification:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MYBPH.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MYBPH.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MYBPH
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-MYBPH (ARP56598_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
BAG3; ELAVL1; UBC; MYBPC2;
Blocking Peptide:
For anti-MYBPH (ARP56598_P050) antibody is Catalog # AAP56598 (Previous Catalog # AAPP39305)
Datasheets/Manuals:
Printable datasheet for anti-MYBPH (ARP56598_P050) antibody
Target Reference:
Welikson,R.E. J. Cell. Sci. 115 (PT 17), 3517-3526 (2002)
Publications:

Conti, A. et al. Increased expression of Myosin binding protein H in the skeletal muscle of amyotrophic lateral sclerosis patients. Biochim. Biophys. Acta 1842, 99-106 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 24184715

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...