Search Antibody, Protein, and ELISA Kit Solutions

MYBPH Antibody - N-terminal region (ARP56598_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP56598_P050-FITC Conjugated

ARP56598_P050-HRP Conjugated

ARP56598_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-165049 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human MYBPH
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 86%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-MYBPH (ARP56598_P050)
Peptide Sequence:
Synthetic peptide located within the following region: LELCREGASEWVPVSARPMMVTQQTVRNLALGDKFLLRVSAVSSAGAGPP
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MYBPH (ARP56598_P050) antibody is Catalog # AAP56598 (Previous Catalog # AAPP39305)
Printable datasheet for anti-MYBPH (ARP56598_P050) antibody
Target Reference:
Welikson,R.E. J. Cell. Sci. 115 (PT 17), 3517-3526 (2002)

Conti, A. et al. Increased expression of Myosin binding protein H in the skeletal muscle of amyotrophic lateral sclerosis patients. Biochim. Biophys. Acta 1842, 99-106 (2014). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 24184715

Gene Symbol:
Official Gene Full Name:
Myosin binding protein H
Alias Symbols:
NCBI Gene Id:
Protein Name:
Myosin-binding protein H
Description of Target:
MYBPH binds to myosin; probably involved in interaction with thick myofilaments in the A-band.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MYBPH.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MYBPH.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...