Catalog No: P100748_P050
Price: $0.00
SKU
P100748_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MYBL2 (P100748_P050) antibody
Product Info
ReferenceTashiro,S.,et al.,(2004) J.Biol.Chem.279(17),17715-17722
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MYBL2
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 85%; Horse: 100%; Human: 100%; Rabbit: 92%; Rat: 78%; Zebrafish: 83%
Peptide SequenceSynthetic peptide located within the following region: RCEDLDELHYQDTDSDVPEQRDSKCKVKWTHEEDEQLRALVRQFGQQDWK
Concentration0.5 mg/ml
Blocking PeptideFor anti-MYBL2 (P100748_P050) antibody is Catalog # AAP31066 (Previous Catalog # AAPP01804)
Sample Type Confirmation

MYBL2 is supported by BioGPS gene expression data to be expressed in HepG2

Gene SymbolMYBL2
Gene Full NameV-myb myeloblastosis viral oncogene homolog (avian)-like 2
Alias SymbolsBMYB, B-MYB
NCBI Gene Id4605
Protein NameMyb-related protein B
Description of TargetMyb-Related Protein B (MYBL2), a member of the MYB family of transcription factor genes, is a nuclear protein involved in cell cycle progression. The encoded protein is phosphorylated by cyclin A/cyclin-dependent kinase 2 during the S-phase of the cell cycle and possesses both activator and repressor activities. It has been shown to activate the cell division cycle 2, cyclin D1, and insulin-like growth factor-binding protein 5 genes. Transcript variants may exist for this gene, but their full-length natures have not been determined.
Uniprot IDP10244
Protein Accession #NP_002457
Nucleotide Accession #NM_002466
Protein Size (# AA)700
Molecular Weight79kDa
Protein InteractionsCCNA1; CDK2; CCNE1; LIN54; SPTBN1; SPTA1; FLNA; CLTC; CLTA; LIN9; UBE2D4; CXCR4; LIN52; LIN37; RBL1; RBBP4; SUMO2; MAP1LC3B; MAPK6; NLK; HIPK2; CREBBP; ZBTB9; TRIM15; LZTR1; CDK9; ZNF622; UBB; TTF2; EP300; SND1; SKP2; MYBL2; NCOR1; NCOR2; PARP1; CCND1; CC
  1. What is the species homology for "MYBL2 Antibody - N-terminal region (P100748_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "MYBL2 Antibody - N-terminal region (P100748_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MYBL2 Antibody - N-terminal region (P100748_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MYBL2 Antibody - N-terminal region (P100748_P050)"?

    This target may also be called "BMYB, B-MYB" in publications.

  5. What is the shipping cost for "MYBL2 Antibody - N-terminal region (P100748_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MYBL2 Antibody - N-terminal region (P100748_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MYBL2 Antibody - N-terminal region (P100748_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "79kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MYBL2 Antibody - N-terminal region (P100748_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MYBL2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MYBL2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MYBL2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MYBL2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MYBL2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MYBL2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MYBL2 Antibody - N-terminal region (P100748_P050)
Your Rating
We found other products you might like!