Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MXD3 antibody - N-terminal region : HRP (ARP30089_T100-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$289.00
In Stock

Conjugation Options

ARP30089_T100 Unconjugated

ARP30089_T100-FITC Conjugated

ARP30089_T100-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
MXD3
NCBI Gene Id:
83463
Official Gene Full Name:
MAX dimerization protein 3
Protein Name:
Max dimerization protein 3
Swissprot Id:
Q9BW11
Protein Accession #:
NP_112590
Nucleotide Accession #:
NM_031300
Alias Symbols:
MYX, MAD3, BHLHC13
Description of Target:
MXD3 contains 1 basic helix-loop-helix (bHLH) domain. It is a transcriptional repressor and binds with MAX to form a sequence-specific DNA-binding protein complex which recognizes the core sequence 5'-CAC[GA]TG-3'. Antagonizes MYC transcriptional activity by competing for MAX and suppresses MYC dependent cell transformation.
Protein Size (# AA):
206
Molecular Weight:
23kDa
Host:
Rabbit
Clonality:
Polyclonal
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MXD3.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MXD3.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MXD3
Species Reactivity:
Cow, Dog, Horse, Human, Mouse, Pig, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 86%; Horse: 93%; Human: 100%; Mouse: 85%; Pig: 86%; Rabbit: 86%; Rat: 93%
Complete computational species homology data:
Anti-MXD3 (ARP30089_T100)
Peptide Sequence:
Synthetic peptide located within the following region: PIHRRKKRPPQAPGAQDSGRSVHNELEKRRRAQLKRCLERLKQQMPLGAD
Product Format:
Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.6-0.7 mg/ml
Protein Interactions:
NOTCH2NL; KRTAP10-7; UBC; NFKB1; MAGEA11; MAX; SIN3A; SMC3;
Blocking Peptide:
For anti-MXD3 (ARP30089_T100-HRP) antibody is Catalog # AAP30089 (Previous Catalog # AAPH00265)
Datasheets/Manuals:
Printable datasheet for anti-MXD3 (ARP30089_T100-HRP) antibody
Conjugation:
HRP
Target Reference:
Suzuki,Y., Gene 200 (1-2), 149-156 (1997)

Tell us what you think about this item!

Write A Review
    Please, wait...