MX1 Antibody - C-terminal region (ARP46077_P050)

Catalog No: ARP46077_P050

MX1 antibody - C-terminal region (ARP46077_P050) validated by WB using human LCL at 1:1000.

Host: Rabbit
Target Name: MX1
Sample Tissue: Human 786-0
Antibody Dilution: 1.0ug/ml

Rabbit Anti-MX1 antibody
Catalog Number: ARP46077
Formalin Fixed Paraffin Embedded Tissue: Human Heart
Primary antibody Concentration: 1:100
Secondary Antibody: Donkey anti-Rabbit-Cy3
Secondary Antibody Concentration: 1:200
Magnification: 20x
Exposure Time: 0.5-2.0sec

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit, Sheep
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB, IHC
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MX1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 93%; Sheep: 86%
• Peptide Sequence: Synthetic peptide located within the following region: KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MX1 (ARP46077_P050) antibody is Catalog # AAP46077 (Previous Catalog # AAPS17311)
• Reference: Hoenen,A., J. Gen. Virol. 88 (PT 11), 3013-3017 (2007)
• Publications:

  Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). 23103828

Target Info

• Gene Symbol: MX1
• Gene Full Name: Myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse)
• Alias Symbols: MX, MxA, IFI78, IFI-78K, lncMX1-215
• NCBI Gene Id: 4599
• Protein Name: Interferon-induced GTP-binding protein Mx1
• Description of Target: In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. MX1 is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. The protein encoded by this gene is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P20591
• Protein Accession #: NP_002453
• Nucleotide Accession #: NM_002462
• Protein Size (# AA): 662
• Molecular Weight: 75kDa
• Protein Interactions: MX1; CAB39L; SIAH1; UBC; APP; ISG15; TRPC7; TRPC3; TRPC1; TRPC4; BLM; TRPC6; DAXX; TRPC5; TUBB; ACTB; PIAS1; SUMO1; SP100; FANCA;