Search Antibody, Protein, and ELISA Kit Solutions

MX1 Antibody - C-terminal region (ARP46077_P050)

100 ul

Regular Price: $319.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP46077_P050-FITC Conjugated

ARP46077_P050-HRP Conjugated

ARP46077_P050-Biotin Conjugated

Tested Species Reactivity:
Human
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB, IHC
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-110081 from Santa Cruz Biotechnology.
Immunogen:
The immunogen is a synthetic peptide directed towards the C terminal region of human MX1
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 93%; Horse: 86%; Human: 100%; Mouse: 86%; Pig: 100%; Rabbit: 86%; Rat: 93%; Sheep: 86%
Complete computational species homology data:
Anti-MX1 (ARP46077_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KAMLQLLQDKDTYSWLLKERSDTSDKRKFLKERLARLTQARRRLAQFPG
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MX1 (ARP46077_P050) antibody is Catalog # AAP46077 (Previous Catalog # AAPS17311)
Datasheets/Manuals:
Printable datasheet for anti-MX1 (ARP46077_P050) antibody
Target Reference:
Hoenen,A., J. Gen. Virol. 88 (PT 11), 3013-3017 (2007)
Publications:

Spellman, C., Ahmed, M. M., Dubach, D. & Gardiner, K. J. Expression of trisomic proteins in Down syndrome model systems. Gene 512, 219-225 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat, Sheep 23103828

Gene Symbol:
MX1
Official Gene Full Name:
Myxovirus (influenza virus) resistance 1, interferon-inducible protein p78 (mouse)
Alias Symbols:
IFI-78K, IFI78, MX, MxA
NCBI Gene Id:
4599
Protein Name:
Interferon-induced GTP-binding protein Mx1
Description of Target:
In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. MX1 is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. In mouse, the interferon-inducible Mx protein is responsible for a specific antiviral state against influenza virus infection. The protein encoded by this gene is similar to the mouse protein as determined by its antigenic relatedness, induction conditions, physicochemical properties, and amino acid analysis. This cytoplasmic protein is a member of both the dynamin family and the family of large GTPases. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
Swissprot Id:
P20591
Protein Accession #:
NP_002453
Nucleotide Accession #:
NM_002462
Protein Size (# AA):
662
Molecular Weight:
75kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MX1.
Protein Interactions:
MX1; CAB39L; SIAH1; UBC; APP; ISG15; TRPC7; TRPC3; TRPC1; TRPC4; BLM; TRPC6; DAXX; TRPC5; TUBB; ACTB; PIAS1; SUMO1; SP100; FANCA;

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...