MVK Antibody - middle region (ARP56110_P050)

Catalog No: ARP56110_P050

WB Suggested Anti-MVK Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:312500
Positive Control: 293T cell lysate

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Goat, Guinea Pig, Horse, Pig, Rabbit, Yeast, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MVK
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 86%; Goat: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Yeast: 93%; Zebrafish: 93%
• Peptide Sequence: Synthetic peptide located within the following region: KEDLELINKWAFQGERMIHGNPSGVDNAVSTWGGALRYHQGKISSLKRSP
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MVK (ARP56110_P050) antibody is Catalog # AAP56110 (Previous Catalog # AAPP38015)
• Reference: Gattorno,M., (2008) (er) Arthritis Rheum. 58 (6), 1823-1832

Target Info

• Gene Symbol: MVK
• Gene Full Name: Mevalonate kinase
• Alias Symbols: MK, LRBP, MVLK, POROK3
• NCBI Gene Id: 4598
• Protein Name: Mevalonate kinase
• Description of Target: MVK is the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobulinaemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestinal dismay and skin rash.This gene encodes the peroxisomal enzyme mevalonate kinase. Mevalonate is a key intermediate, and mevalonate kinase a key early enzyme, in isoprenoid and sterol synthesis. Mevalonate kinase deficiency caused by mutation of this gene results in mevalonic aciduria, a disease characterized psychomotor retardation, failure to thrive, hepatosplenomegaly, anemia and recurrent febrile crises. Defects in this gene also cause hyperimmunoglobulinaemia D and periodic fever syndrome, a disorder characterized by recurrent episodes of fever associated with lymphadenopathy, arthralgia, gastrointestinal dismay and skin rash. Two transcript variants that encode the same protein have been found for this gene.
• Uniprot ID: Q03426
• Protein Accession #: NP_000422
• Nucleotide Accession #: NM_000431
• Protein Size (# AA): 396
• Molecular Weight: 42kDa
• Protein Interactions: MVK; PPP1CB; GSS; MAT1A; POT1; TERF1; UBC; EWSR1;