MUP11 Recombinant Protein (Mouse) (OPCA02946)

Catalog No: OPCA02946

Mup8 Recombinant Protein (Mouse) (OPCA02946) in SDS-PAGE showing the molecular weight of approximately 17.5 kDa.

Product Info

• Predicted Species Reactivity: Mouse|Mus musculus
• Product Format: Liquid or Lyophilized powder
• Host: Mouse
• Additional Information: Relevance: Binds pheromones that are released from drying urine of males. These pheromones affect the sexual behavior of fales.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
• Protein Sequence: REKINGEWHTIILASDKREKIEDNGNFRLFLEQIHVLENSLVLKFHTVRDEECSELSMVADKTEKAGEYSVTYDGFNTFTIPKTDYDNFLMAHLINEKDGETFQLMGLYGREPDLSSDIKERFAQLCEEHGILRENIIDLSNANRCLQARE
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: Yeast
• Protein Range: 1-151 aa
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Analysis of mouse major urinary protein genes variation between the exonic sequences of group 1 genes and a comparison with an active gene out with group 1 both suggest that gene conversion has occurred between MUP genes.Clark A.J., Chave-Cox A., Ma X., Bishop J.O.EMBO J. 4:3167-3171(1985)
• Gene Symbol: Mup11|Mup18
• Gene Full Name: major urinary protein 11|major urinary protein 18
• Alias Symbols: 100039228;alpha-2U-globulin;Gm12549;Gm12561;group 1, BS6;major urinary protein 11;major urinary protein 16;Major urinary protein 18;Major urinary protein 6;major urinary protein 9;MUP 6;Mup16;Mup18;Mup6;Mup9.
• NCBI Gene Id: 100039028|100048884
• Protein Name: Major urinary protein 11
• Description of Target: Major urinary proteins (Mups) bind pheromones, and thus stabilize them to allow slow release into the air from urine marks. May protect pheromones from oxidation. May also act as pheromones themselves. In this context, they play a role in the regulation of social behaviors, such as aggression, mating, pup-suckling, territory establishment and dominance (Probable). Binds the pheromone analog 2-sec-butyl-4,5-dihydrothiazole (SBT) in vitro (PubMed:25279835).
• Uniprot ID: P04938
• Protein Accession #: NP_001157998.1
  
• Nucleotide Accession #: NM_001164526.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 19.6 kDa