Search Antibody, Protein, and ELISA Kit Solutions

MUC3B antibody - N-terminal region (ARP58395_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP58395_P050-FITC Conjugated

ARP58395_P050-HRP Conjugated

ARP58395_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
NCBI Gene Id:
Official Gene Full Name:
Mucin 3B, cell surface associated
Swissprot Id:
Protein Accession #:
Alias Symbols:
Description of Target:
MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MUC3B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MUC3B.
The immunogen is a synthetic peptide directed towards the N terminal region of human MUC3B
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-MUC3B (ARP58395_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MUC3B (ARP58395_P050) antibody is Catalog # AAP58395 (Previous Catalog # AAPP33404)
Printable datasheet for anti-MUC3B (ARP58395_P050) antibody
Target Reference:

Song, J. S. et al. Comparative gene expression analysis of the human periodontal ligament in deciduous and permanent teeth. PLoS One 8, e61231 (2013). WB, Human 23593441

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...