MUC3B Antibody - N-terminal region (ARP58395_P050)

Catalog#: ARP58395_P050

• Size: 100 ul

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MUC3B
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Human: 100%
• Peptide Sequence: Synthetic peptide located within the following region: KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-MUC3B (ARP58395_P050) antibody is Catalog # AAP58395 (Previous Catalog # AAPP33404)
• Target Reference: 0
• Publications:

  Song, J. S. et al. Comparative gene expression analysis of the human periodontal ligament in deciduous and permanent teeth. PLoS One 8, e61231 (2013). WB, Human 23593441

• Gene Symbol: MUC3B
• Official Gene Full Name: Mucin 3B, cell surface associated
• Alias Symbols: MUC3, MUC3A
• NCBI Gene Id: 57876
• Description of Target: MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
• Swissprot Id: Q9H195
• Protein Accession #: XP_001718007
• Protein Size (# AA): 310
• Molecular Weight: 34kDa
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express MUC3B.

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: MUC3B antibody tested with Human Mcf7 Cells (ARP58395_P050)