- Gene Symbol:
- MUC3B
- NCBI Gene Id:
- 57876
- Official Gene Full Name:
- Mucin 3B, cell surface associated
- Swissprot Id:
- Q9H195
- Protein Accession #:
- XP_001718007
- Alias Symbols:
- MUC3, MUC3A
- Description of Target:
- MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
- Protein Size (# AA):
- 310
- Molecular Weight:
- 34kDa
- Host:
- Rabbit
- Clonality:
- Polyclonal
- Purification:
- Affinity Purified
- Application:
- WB
- Tissue Tool:
- Find tissues and cell lines supported by DNA array analysis to express MUC3B.
- RNA Seq:
- Find tissues and cell lines supported by RNA-seq analysis to express MUC3B.
- Immunogen:
- The immunogen is a synthetic peptide directed towards the N terminal region of human MUC3B
- Tested Species Reactivity:
- Human
- Predicted Homology Based on Immunogen Sequence:
- Human: 100%
- Complete computational species homology data:
- Anti-MUC3B (ARP58395_P050)
- Peptide Sequence:
- Synthetic peptide located within the following region: KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI
- Product Format:
- Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
- Reconstitution and Storage:
- For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
- Concentration:
- Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
- Blocking Peptide:
- For anti-MUC3B (ARP58395_P050) antibody is Catalog # AAP58395 (Previous Catalog # AAPP33404)
- Datasheets/Manuals:
- Printable datasheet for anti-MUC3B (ARP58395_P050) antibody
- Target Reference:
- 0
- Publications:
Song, J. S. et al. Comparative gene expression analysis of the human periodontal ligament in deciduous and permanent teeth. PLoS One 8, e61231 (2013). WB, Human 23593441
Product Reviews
- Protocol:
- Tips Information:
See our General FAQ page.
