Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
Request Bulk
Order Quote
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email:
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP58395_P050-FITC Conjugated

ARP58395_P050-HRP Conjugated

ARP58395_P050-Biotin Conjugated

MUC3B Antibody - N-terminal region (ARP58395_P050)

Catalog#: ARP58395_P050
Domestic: within 1-2 days delivery | International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MUC3B
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%
Complete computational species homology data Anti-MUC3B (ARP58395_P050)
Peptide Sequence Synthetic peptide located within the following region: KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MUC3B (ARP58395_P050) antibody is Catalog # AAP58395 (Previous Catalog # AAPP33404)
Datasheets/Manuals Printable datasheet for anti-MUC3B (ARP58395_P050) antibody
Target Reference 0

Song, J. S. et al. Comparative gene expression analysis of the human periodontal ligament in deciduous and permanent teeth. PLoS One 8, e61231 (2013). WB, Human 23593441

Gene Symbol MUC3B
Official Gene Full Name Mucin 3B, cell surface associated
Alias Symbols MUC3, MUC3A
NCBI Gene Id 57876
Description of Target MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
Swissprot Id Q9H195
Protein Accession # XP_001718007
Protein Size (# AA) 310
Molecular Weight 34kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MUC3B.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MUC3B.
  1. What is the species homology for "MUC3B Antibody - N-terminal region (ARP58395_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "MUC3B Antibody - N-terminal region (ARP58395_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MUC3B Antibody - N-terminal region (ARP58395_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact

  4. What are other names for "MUC3B Antibody - N-terminal region (ARP58395_P050)"?

    This target may also be called "MUC3, MUC3A" in publications.

  5. What is the shipping cost for "MUC3B Antibody - N-terminal region (ARP58395_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MUC3B Antibody - N-terminal region (ARP58395_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MUC3B Antibody - N-terminal region (ARP58395_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "34kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MUC3B Antibody - N-terminal region (ARP58395_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MUC3B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MUC3B"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MUC3B"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MUC3B"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MUC3B"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MUC3B"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MUC3B Antibody - N-terminal region (ARP58395_P050)
Your Rating
We found other products you might like!