Search Antibody, Protein, and ELISA Kit Solutions

MUC3B Antibody - N-terminal region (ARP58395_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP58395_P050-FITC Conjugated

ARP58395_P050-HRP Conjugated

ARP58395_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Tested Species Reactivity:
Human
Predicted Species Reactivity:
Human
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality:
Polyclonal
Host:
Rabbit
Application:
WB
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MUC3B
Purification:
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Human: 100%
Complete computational species homology data:
Anti-MUC3B (ARP58395_P050)
Peptide Sequence:
Synthetic peptide located within the following region: KSGYAFVDCPDEHWAMKAIETFSGKVELQGKRLEIEHSVPKKQRSRKIQI
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MUC3B (ARP58395_P050) antibody is Catalog # AAP58395 (Previous Catalog # AAPP33404)
Datasheets/Manuals:
Printable datasheet for anti-MUC3B (ARP58395_P050) antibody
Target Reference:
0
Publications:

Song, J. S. et al. Comparative gene expression analysis of the human periodontal ligament in deciduous and permanent teeth. PLoS One 8, e61231 (2013). WB, Human 23593441

Gene Symbol:
MUC3B
Official Gene Full Name:
Mucin 3B, cell surface associated
Alias Symbols:
MUC3, MUC3A
NCBI Gene Id:
57876
Description of Target:
MUC3B is major glycoprotein component of a variety of mucus gels. It is thought to provide a protective, lubricating barrier against particles and infectious agents at mucosal surfaces.
Swissprot Id:
Q9H195
Protein Accession #:
XP_001718007
Protein Size (# AA):
310
Molecular Weight:
34kDa
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MUC3B.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MUC3B.

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...