Search Antibody, Protein, and ELISA Kit Solutions

MUC1 Antibody - C-terminal region (ARP41446_T100)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP41446_T100-FITC Conjugated

ARP41446_T100-HRP Conjugated

ARP41446_T100-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Mucin 1, cell surface associated
NCBI Gene Id:
Protein Name:
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CD227, EMA, PEM, PUM, mucin, KL-6, MAM6, PEMT, H23AG, MUC-1, MUC-1/X, MUC1/ZD, MUC-1/SEC
Replacement Item:
This antibody may replace item sc-15333, HPA008855
Description of Target:
MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.
Protein Size (# AA):
Molecular Weight:
Protein A purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MUC1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MUC1.
The immunogen is a synthetic peptide directed towards the C terminal region of human MUC1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human, Pig
Predicted Homology Based on Immunogen Sequence:
Cow: 86%; Dog: 100%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 92%; Rat: 92%
Complete computational species homology data:
Anti-MUC1 (ARP41446_T100)
Peptide Sequence:
Synthetic peptide located within the following region: RRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MUC1 (ARP41446_T100) antibody is Catalog # AAP41446 (Previous Catalog # AAPP24183)
Printable datasheet for anti-MUC1 (ARP41446_T100) antibody

Braun, HS; Sponder, G; Pieper, R; Aschenbach, JR; Deiner, C; GABA selectively increases mucin-1 expression in isolated pig jejunum. 10, 47 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26471792

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...