Size:100 ul
$249.00
In stock
SKU
ARP41446_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41446_T100-FITC Conjugated

ARP41446_T100-HRP Conjugated

ARP41446_T100-Biotin Conjugated

MUC1 Antibody - C-terminal region (ARP41446_T100)

Catalog#: ARP41446_T100
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman, Pig
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationIHC, WB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-15333, HPA008855
ImmunogenThe immunogen is a synthetic peptide directed towards the C terminal region of human MUC1
PurificationProtein A purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Dog: 100%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 92%; Rat: 92%
Complete computational species homology dataAnti-MUC1 (ARP41446_T100)
Peptide SequenceSynthetic peptide located within the following region: RRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGN
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MUC1 (ARP41446_T100) antibody is Catalog # AAP41446 (Previous Catalog # AAPP24183)
Datasheets/ManualsPrintable datasheet for anti-MUC1 (ARP41446_T100) antibody
Publications

Braun, HS; Sponder, G; Pieper, R; Aschenbach, JR; Deiner, C; GABA selectively increases mucin-1 expression in isolated pig jejunum. 10, 47 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26471792

Gene SymbolMUC1
Official Gene Full NameMucin 1, cell surface associated
Alias SymbolsCD227, EMA, PEM, PUM, mucin, KL-6, MAM6, PEMT, H23AG, MUC-1, MUC-1/X, MUC1/ZD, MUC-1/SEC
NCBI Gene Id4582
Protein NameMucin-1
Description of TargetMUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.
Swissprot IdQ7Z552
Protein Accession #NP_001037855
Nucleotide Accession #NM_001044390
Protein Size (# AA)203
Molecular Weight22kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MUC1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MUC1.
Protein InteractionsUBC; PPARG; IPO5; NUP62; EGFR; ABL1; SRC; JUN; TP53; TBP; IKBKG; TNFRSF1A; IKBKB; GRB2; ESR1; GALNT15; GALNT12; GALNT10; OSGEP; GSK3B; GALNT2; GALNT1; CTNND1; SIGLEC1; ERBB4; ERBB3; SOS1; PRKCD; ZAP70; APC; JUP; LYN; ERBB2; LCK; CTNNB1; GALNT4; BAX; CDKN1
Write Your Own Review
You're reviewing:MUC1 Antibody - C-terminal region (ARP41446_T100)
Your Rating
Aviva Pathways
Aviva Travel Grant
Aviva Validation Data
Free Microscope