Size:100 ul
$249.00
In Stock
SKU
ARP41446_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41446_T100-FITC Conjugated

ARP41446_T100-HRP Conjugated

ARP41446_T100-Biotin Conjugated

MUC1 Antibody - C-terminal region (ARP41446_T100)

Catalog#: ARP41446_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human, Pig
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-15333, HPA008855
Immunogen The immunogen is a synthetic peptide directed towards the C terminal region of human MUC1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 86%; Dog: 100%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 86%; Rabbit: 92%; Rat: 92%
Complete computational species homology data Anti-MUC1 (ARP41446_T100)
Peptide Sequence Synthetic peptide located within the following region: RRKNYGQLDIFPARDTYHPMSEYPTYHTHGRYVPPSSTDRSPYEKVSAGN
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MUC1 (ARP41446_T100) antibody is Catalog # AAP41446 (Previous Catalog # AAPP24183)
Datasheets/Manuals Printable datasheet for anti-MUC1 (ARP41446_T100) antibody
Publications

Braun, HS; Sponder, G; Pieper, R; Aschenbach, JR; Deiner, C; GABA selectively increases mucin-1 expression in isolated pig jejunum. 10, 47 (2015). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 26471792

Gene Symbol MUC1
Official Gene Full Name Mucin 1, cell surface associated
Alias Symbols CD227, EMA, PEM, PUM, mucin, KL-6, MAM6, PEMT, H23AG, MUC-1, MUC-1/X, MUC1/ZD, MUC-1/SEC
NCBI Gene Id 4582
Protein Name Mucin-1
Description of Target MUC1 is a membrane bound, glycosylated phosphoprotein. The protein is anchored to the apical surface of many epithelia by a transmembrane domain, with the degree of glycosylation varying with cell type. It also includes a 20 aa variable number tandem repeat (VNTR) domain, with the number of repeats varying from 20 to 120 in different individuals. The protein serves a protective function by binding to pathogens and also functions in a cell signaling capacity. Overexpression, aberrant intracellular localization, and changes in glycosylation of this protein have been associated with carcinomas.
Swissprot Id Q7Z552
Protein Accession # NP_001037855
Nucleotide Accession # NM_001044390
Protein Size (# AA) 203
Molecular Weight 22kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MUC1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MUC1.
Protein Interactions UBC; PPARG; IPO5; NUP62; EGFR; ABL1; SRC; JUN; TP53; TBP; IKBKG; TNFRSF1A; IKBKB; GRB2; ESR1; GALNT15; GALNT12; GALNT10; OSGEP; GSK3B; GALNT2; GALNT1; CTNND1; SIGLEC1; ERBB4; ERBB3; SOS1; PRKCD; ZAP70; APC; JUP; LYN; ERBB2; LCK; CTNNB1; GALNT4; BAX; CDKN1
  1. What is the species homology for "MUC1 Antibody - C-terminal region (ARP41446_T100)"?

    The tested species reactivity for this item is "Human, Pig". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat".

  2. How long will it take to receive "MUC1 Antibody - C-terminal region (ARP41446_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MUC1 Antibody - C-terminal region (ARP41446_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MUC1 Antibody - C-terminal region (ARP41446_T100)"?

    This target may also be called "CD227, EMA, PEM, PUM, mucin, KL-6, MAM6, PEMT, H23AG, MUC-1, MUC-1/X, MUC1/ZD, MUC-1/SEC" in publications.

  5. What is the shipping cost for "MUC1 Antibody - C-terminal region (ARP41446_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MUC1 Antibody - C-terminal region (ARP41446_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MUC1 Antibody - C-terminal region (ARP41446_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "22kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MUC1 Antibody - C-terminal region (ARP41446_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MUC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MUC1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MUC1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MUC1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MUC1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MUC1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MUC1 Antibody - C-terminal region (ARP41446_T100)
Your Rating
We found other products you might like!