Now Offering Over 102,157 Antibodies & 44,722 Antigens!

MTX2 antibody - N-terminal region (ARP51788_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
100 ul
$319.00
In Stock

Conjugation Options

ARP51788_P050-FITC Conjugated

ARP51788_P050-HRP Conjugated

ARP51788_P050-Biotin Conjugated

Click here to learn more about Aviva's By-Request Conjugation Service.
Gene Symbol:
MTX2
NCBI Gene Id:
10651
Official Gene Full Name:
Metaxin 2
Protein Name:
Metaxin 2 EMBL AAH17271.1
Swissprot Id:
Q8IZ68
Protein Accession #:
NP_001006636
Nucleotide Accession #:
NM_001006635
Alias Symbols:
MGC111067
Description of Target:
MTX2 is highly similar to the metaxin 2 protein from mouse, which has been shown to interact with the mitochondrial membrane protein metaxin 1. Because of this similarity, it is thought that the encoded protein is peripherally associated with the cytosolic face of the outer mitochondrial membrane and be involved in the import of proteins into the mitochondrion.The protein encoded by this gene is highly similar to the metaxin 2 protein from mouse, which has been shown to interact with the mitochondrial membrane protein metaxin 1. Because of this similarity, it is thought that the encoded protein is peripherally associated with the cytosolic face of the outer mitochondrial membrane and be involved in the import of proteins into the mitochondrion. Two transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
253
Molecular Weight:
29kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MTX2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MTX2.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MTX2
Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 93%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-MTX2 (ARP51788_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YIAAEPWPENATLYQQLKGEQILLSDNAASLAVQAFLQMCNLPIKVVCRA
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
CCDC155; TADA2A; MMGT1; HNRNPR; SLC25A3; UBC; MINOS1; MTX1;
Blocking Peptide:
For anti-MTX2 (ARP51788_P050) antibody is Catalog # AAP51788 (Previous Catalog # AAPY03522)
Datasheets/Manuals:
Printable datasheet for anti-MTX2 (ARP51788_P050) antibody
Sample Type Confirmation:

MTX2 is supported by BioGPS gene expression data to be expressed in Jurkat

Target Reference:
Xie,J., (2007) FEBS Lett. 581 (18), 3545-3549

Tell us what you think about this item!

Write A Review
    Please, wait...