Search Antibody, Protein, and ELISA Kit Solutions

MTTP Antibody - N-terminal region (ARP43618_P050)

100 ul
$319.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP43618_P050-FITC Conjugated

ARP43618_P050-HRP Conjugated

ARP43618_P050-Biotin Conjugated

Gene Symbol:
MTTP
Official Gene Full Name:
Microsomal triglyceride transfer protein
NCBI Gene Id:
4547
Protein Name:
Microsomal triglyceride transfer protein large subunit
Swissprot Id:
P55157
Protein Accession #:
NP_000244
Nucleotide Accession #:
NM_000253
Alias Symbols:
ABL, MGC149819, MGC149820, MTP
Replacement Item:
This antibody may replace item sc-33116 from Santa Cruz Biotechnology.
Description of Target:
MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.
Protein Size (# AA):
894
Molecular Weight:
97kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MTTP.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MTTP.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MTTP
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-MTTP (ARP43618_P050)
Peptide Sequence:
Synthetic peptide located within the following region: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
HSP90B1; APOB;
Blocking Peptide:
For anti-MTTP (ARP43618_P050) antibody is Catalog # AAP43618 (Previous Catalog # AAPS15812)
Datasheets/Manuals:
Printable datasheet for anti-MTTP (ARP43618_P050) antibody
Sample Type Confirmation:

MTTP is supported by BioGPS gene expression data to be expressed in HepG2

Target Reference:
Lundahl,B., Am. J. Physiol. Endocrinol. Metab. 290 (4), E739-E745 (2006)
Publications:

Lee, S; Bao, H; Ishikawa, Z; Wang, W; Lim, HY; Cardiomyocyte Regulation of Systemic Lipid Metabolism by the Apolipoprotein B-Containing Lipoproteins in Drosophila. 13, e1006555 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 28095410

Ward, AB; Dail, MB; Chambers, JE; In Vitro effect of DDE exposure on the regulation of lipid metabolism and secretion in McA-RH7777 hepatocytes: A potential role in dyslipidemia which may increase the risk of type 2 diabetes mellitus. 37, 9-14 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27565303

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...