Size:100 ul
$319.00
In stock
SKU
ARP43618_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP43618_P050-FITC Conjugated

ARP43618_P050-HRP Conjugated

ARP43618_P050-Biotin Conjugated

MTTP Antibody - N-terminal region (ARP43618_P050)

Catalog#: ARP43618_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-33116 from Santa Cruz Biotechnology.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MTTP
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology dataAnti-MTTP (ARP43618_P050)
Peptide SequenceSynthetic peptide located within the following region: MILLAVLFLCFISSYSASVKGHTTGLSLNNDRLYKLTYSTEVLLDRGKGK
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MTTP (ARP43618_P050) antibody is Catalog # AAP43618 (Previous Catalog # AAPS15812)
Datasheets/ManualsPrintable datasheet for anti-MTTP (ARP43618_P050) antibody
Sample Type Confirmation

MTTP is supported by BioGPS gene expression data to be expressed in HepG2

Target ReferenceLundahl,B., Am. J. Physiol. Endocrinol. Metab. 290 (4), E739-E745 (2006)
Publications

Lee, S; Bao, H; Ishikawa, Z; Wang, W; Lim, HY; Cardiomyocyte Regulation of Systemic Lipid Metabolism by the Apolipoprotein B-Containing Lipoproteins in Drosophila. 13, e1006555 (2017). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 28095410

Ward, AB; Dail, MB; Chambers, JE; In Vitro effect of DDE exposure on the regulation of lipid metabolism and secretion in McA-RH7777 hepatocytes: A potential role in dyslipidemia which may increase the risk of type 2 diabetes mellitus. 37, 9-14 (2016). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat 27565303

Gene SymbolMTTP
Official Gene Full NameMicrosomal triglyceride transfer protein
Alias SymbolsABL, MGC149819, MGC149820, MTP
NCBI Gene Id4547
Protein NameMicrosomal triglyceride transfer protein large subunit
Description of TargetMTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.MTP encodes the large subunit of the heterodimeric microsomal triglyceride transfer protein. Protein disulfide isomerase (PDI) completes the heterodimeric microsomal triglyceride transfer protein, which has been shown to play a central role in lipoprotein assembly. Mutations in MTP can cause abetalipoproteinemia.
Swissprot IdP55157
Protein Accession #NP_000244
Nucleotide Accession #NM_000253
Protein Size (# AA)894
Molecular Weight97kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MTTP.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MTTP.
Protein InteractionsHSP90B1; APOB;
Write Your Own Review
You're reviewing:MTTP Antibody - N-terminal region (ARP43618_P050)
Your Rating
Aviva Validation Data
Aviva HIS tag Deal
Free Microscope
Aviva Pathways