Size:100 ul
Special Price $229.00 Regular Price $289.00
In stock
SKU
ARP57657_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP57657_P050-FITC Conjugated

ARP57657_P050-HRP Conjugated

ARP57657_P050-Biotin Conjugated

MTRR Antibody - N-terminal region (ARP57657_P050)

Catalog#: ARP57657_P050
Domestic: within 1-2 days delivery International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB, IHC
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-48889 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MTRR
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data Anti-MTRR (ARP57657_P050)
Peptide Sequence Synthetic peptide located within the following region: YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MTRR (ARP57657_P050) antibody is Catalog # AAP57657 (Previous Catalog # AAPP42044)
Datasheets/Manuals Printable datasheet for anti-MTRR (ARP57657_P050) antibody
Sample Type Confirmation

MTRR is strongly supported by BioGPS gene expression data to be expressed in HeLa

Publications

Richard, E., Desviat, L. R., Ugarte, M. & Pérez, B. Oxidative stress and apoptosis in homocystinuria patients with genetic remethylation defects. J. Cell. Biochem. 114, 183-91 (2013). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22887477

Gene Symbol MTRR
Official Gene Full Name 5-methyltetrahydrofolate-homocysteine methyltransferase reductase
Alias Symbols MGC129643, MSR, cblE
NCBI Gene Id 4552
Protein Name Methionine synthase reductase
Description of Target Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor. The protein encoded by this gene regenerates a functional methionine synthase via reductive methylation. It is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Patients of the cbl-E complementation group of disorders of folate/cobalamin metabolism are defective in reductive activation of methionine synthase. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.
Swissprot Id Q9UBK8
Protein Accession # NP_076915
Nucleotide Accession # NM_024010
Protein Size (# AA) 725
Molecular Weight 80kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MTRR.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MTRR.
Protein Interactions GMCL1; PAPSS1; HIST1H2AG; FH; ELAVL1; UBC; MMAB;
Write Your Own Review
You're reviewing:MTRR Antibody - N-terminal region (ARP57657_P050)
Your Rating