Search Antibody, Protein, and ELISA Kit Solutions

MTRR Antibody - N-terminal region (ARP57657_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP57657_P050-FITC Conjugated

ARP57657_P050-HRP Conjugated

ARP57657_P050-Biotin Conjugated

Gene Symbol:
MTRR
Official Gene Full Name:
5-methyltetrahydrofolate-homocysteine methyltransferase reductase
NCBI Gene Id:
4552
Protein Name:
Methionine synthase reductase
Swissprot Id:
Q9UBK8
Protein Accession #:
NP_076915
Nucleotide Accession #:
NM_024010
Alias Symbols:
MGC129643, MSR, cblE
Replacement Item:
This antibody may replace item sc-48889 from Santa Cruz Biotechnology.
Description of Target:
Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor. The protein encoded by this gene regenerates a functional methionine synthase via reductive methylation. It is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Patients of the cbl-E complementation group of disorders of folate/cobalamin metabolism are defective in reductive activation of methionine synthase. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.
Protein Size (# AA):
725
Molecular Weight:
80kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB, IHC
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MTRR.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MTRR.
Immunogen:
The immunogen is a synthetic peptide directed towards the N terminal region of human MTRR
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%
Complete computational species homology data:
Anti-MTRR (ARP57657_P050)
Peptide Sequence:
Synthetic peptide located within the following region: YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
GMCL1; PAPSS1; HIST1H2AG; FH; ELAVL1; UBC; MMAB;
Blocking Peptide:
For anti-MTRR (ARP57657_P050) antibody is Catalog # AAP57657 (Previous Catalog # AAPP42044)
Datasheets/Manuals:
Printable datasheet for anti-MTRR (ARP57657_P050) antibody
Sample Type Confirmation:

MTRR is strongly supported by BioGPS gene expression data to be expressed in HeLa

Publications:

Richard, E., Desviat, L. R., Ugarte, M. & Pérez, B. Oxidative stress and apoptosis in homocystinuria patients with genetic remethylation defects. J. Cell. Biochem. 114, 183-91 (2013). WB, IHC, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat 22887477

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...