- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for anti-MTRR (ARP57657_P050) antibody |
---|
Tested Species Reactivity | Human |
---|---|
Predicted Species Reactivity | Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit |
Product Format | Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose. |
Clonality | Polyclonal |
Host | Rabbit |
Application | WB, IHC |
Reconstitution and Storage | For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles. |
Immunogen | The immunogen is a synthetic peptide directed towards the N terminal region of human MTRR |
Purification | Affinity Purified |
Predicted Homology Based on Immunogen Sequence | Cow: 93%; Dog: 100%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100% |
Peptide Sequence | Synthetic peptide located within the following region: YDLKTETAPLVVVVSTTGTGDPPDTARKFVKEIQNQTLPVDFFAHLRYGL |
Concentration | 0.5 mg/ml |
Blocking Peptide | For anti-MTRR (ARP57657_P050) antibody is Catalog # AAP57657 (Previous Catalog # AAPP42044) |
Sample Type Confirmation | MTRR is strongly supported by BioGPS gene expression data to be expressed in HeLa |
Publications | Richard, E., Desviat, L. R., Ugarte, M. & Pérez, B. Oxidative stress and apoptosis in homocystinuria patients with genetic remethylation defects. J. Cell. Biochem. 114, 183-91 (2013). 22887477 |
Gene Symbol | MTRR |
---|---|
Gene Full Name | 5-methyltetrahydrofolate-homocysteine methyltransferase reductase |
Alias Symbols | MSR, cblE |
NCBI Gene Id | 4552 |
Protein Name | Methionine synthase reductase |
Description of Target | Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor. The protein encoded by this gene regenerates a functional methionine synthase via reductive methylation. It is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Patients of the cbl-E complementation group of disorders of folate/cobalamin metabolism are defective in reductive activation of methionine synthase. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms. |
Uniprot ID | Q9UBK8 |
Protein Accession # | NP_076915 |
Nucleotide Accession # | NM_024010 |
Protein Size (# AA) | 725 |
Molecular Weight | 80kDa |
Protein Interactions | GMCL1; PAPSS1; HIST1H2AG; FH; ELAVL1; UBC; MMAB; |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "MTRR Antibody - N-terminal region (ARP57657_P050)"?
The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Pig, Rabbit".
-
How long will it take to receive "MTRR Antibody - N-terminal region (ARP57657_P050)"?
This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".
-
What buffer format is "MTRR Antibody - N-terminal region (ARP57657_P050)" provided in?
This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "MTRR Antibody - N-terminal region (ARP57657_P050)"?
This target may also be called "MSR, cblE" in publications.
-
What is the shipping cost for "MTRR Antibody - N-terminal region (ARP57657_P050)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "MTRR Antibody - N-terminal region (ARP57657_P050)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "MTRR Antibody - N-terminal region (ARP57657_P050)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "80kDa".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "MTRR Antibody - N-terminal region (ARP57657_P050)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "MTRR"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "MTRR"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "MTRR"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "MTRR"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "MTRR"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "MTRR"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.