MTRR Antibody - middle region : Biotin (ARP74073_P050-Biotin)

Catalog No: ARP74073_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB, IHC
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of Human MTRR
• Purification: Affinity Purified
• Peptide Sequence: Synthetic peptide located within the following region: LQPNIHASHEDSGKALAPKISISPRTTNSFHLPDDPSIPIIMVGPGTGIA
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MTRR (ARP74073_P050-Biotin) antibody is Catalog # AAP74073

Target Info

• Gene Symbol: MTRR
• Alias Symbols: MSR, cblE
• NCBI Gene Id: 4552
• Description of Target: Methionine is an essential amino acid required for protein synthesis and one-carbon metabolism. Its synthesis is catalyzed by the enzyme methionine synthase. Methionine synthase eventually becomes inactive due to the oxidation of its cob(I)alamin cofactor. The protein encoded by this gene regenerates a functional methionine synthase via reductive methylation. It is a member of the ferredoxin-NADP(+) reductase (FNR) family of electron transferases. Patients of the cbl-E complementation group of disorders of folate/cobalamin metabolism are defective in reductive activation of methionine synthase. Alternative splicing of this gene results in multiple transcript variants encoding distinct isoforms.
• Uniprot ID: Q9UBK8-2
• Protein Size (# AA): 698
• Molecular Weight: 76kDa
• Protein Interactions: GMCL1; PAPSS1; HIST1H2AG; FH; ELAVL1; UBC; MMAB;