Catalog No: ARP56319_P050
Price: $0.00
SKU
ARP56319_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

MTRF1L Antibody - N-terminal region (ARP56319_P050)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-MTRF1L (ARP56319_P050) antibody
Product Info
ReferenceNozaki,Y., (2008) Genes Cells 13 (5), 429-438
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human RF1ML
PurificationAffinity purified
Predicted Homology Based on Immunogen SequenceCow: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 77%; Rabbit: 92%; Rat: 83%
Peptide SequenceSynthetic peptide located within the following region: MRSRVLWGAARWLWPRRAVGPARRPLSSGSPPLEELFTRGGPLRTFLERQ
Concentration0.5 mg/ml
Blocking PeptideFor anti-MTRF1L (ARP56319_P050) antibody is Catalog # AAP56319
Gene SymbolMTRF1L
Gene Full Namemitochondrial translational release factor 1 like
Alias SymbolsMRF1L, HMRF1L, mtRF1a
NCBI Gene Id54516
Protein Namepeptide chain release factor 1-like, mitochondrial
Description of TargetThe protein encoded by this gene plays a role in mitochondrial translation termination, and is thought to be a release factor that is involved in the dissociation of the complete protein from the final tRNA, the ribosome, and the cognate mRNA. This protein acts upon UAA and UAG stop codons, but has no in vitro activity against UGA, which encodes tryptophan in human mitochondrion, or, the mitochondrial non-cognate stop codons, AGA and AGG. This protein shares sequence similarity to bacterial release factors. Pseudogenes of this gene are found on chromosomes 4, 8, and 11. Alternative splicing results in multiple transcript variants.
Uniprot IDQ9UGC7
Protein Accession #NP_001107656
Nucleotide Accession #NM_001114184.2
Protein Size (# AA)271
Molecular Weight29 kDa
Protein InteractionsUBC;
  1. What is the species homology for "MTRF1L Antibody - N-terminal region (ARP56319_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "MTRF1L Antibody - N-terminal region (ARP56319_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "MTRF1L Antibody - N-terminal region (ARP56319_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MTRF1L Antibody - N-terminal region (ARP56319_P050)"?

    This target may also be called "MRF1L, HMRF1L, mtRF1a" in publications.

  5. What is the shipping cost for "MTRF1L Antibody - N-terminal region (ARP56319_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MTRF1L Antibody - N-terminal region (ARP56319_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MTRF1L Antibody - N-terminal region (ARP56319_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "29 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MTRF1L Antibody - N-terminal region (ARP56319_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MTRF1L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MTRF1L"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MTRF1L"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MTRF1L"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MTRF1L"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MTRF1L"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MTRF1L Antibody - N-terminal region (ARP56319_P050)
Your Rating