MTRF1L Antibody - N-terminal region (ARP56319_P050)

Catalog No: ARP56319_P050

Click here to learn more about Aviva's By-Request Conjugation Service.

Host: Rabbit
Target Name: RF1ML
Sample Tissue: Thymus Tumor lysates
Antibody Dilution: 1.0ug/ml

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human RF1ML
• Purification: Affinity purified
• Predicted Homology Based on Immunogen Sequence: Cow: 86%; Guinea Pig: 93%; Horse: 93%; Human: 100%; Mouse: 77%; Rabbit: 92%; Rat: 83%
• Peptide Sequence: Synthetic peptide located within the following region: MRSRVLWGAARWLWPRRAVGPARRPLSSGSPPLEELFTRGGPLRTFLERQ
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MTRF1L (ARP56319_P050) antibody is Catalog # AAP56319
• Reference: Nozaki,Y., (2008) Genes Cells 13 (5), 429-438

Target Info

• Gene Symbol: MTRF1L
• Gene Full Name: mitochondrial translational release factor 1 like
• Alias Symbols: MRF1L, HMRF1L, mtRF1a
• NCBI Gene Id: 54516
• Protein Name: peptide chain release factor 1-like, mitochondrial
• Description of Target: The protein encoded by this gene plays a role in mitochondrial translation termination, and is thought to be a release factor that is involved in the dissociation of the complete protein from the final tRNA, the ribosome, and the cognate mRNA. This protein acts upon UAA and UAG stop codons, but has no in vitro activity against UGA, which encodes tryptophan in human mitochondrion, or, the mitochondrial non-cognate stop codons, AGA and AGG. This protein shares sequence similarity to bacterial release factors. Pseudogenes of this gene are found on chromosomes 4, 8, and 11. Alternative splicing results in multiple transcript variants.
• Uniprot ID: Q9UGC7
• Protein Accession #: NP_001107656
• Nucleotide Accession #: NM_001114184.2
• Protein Size (# AA): 271
• Molecular Weight: 29 kDa
• Protein Interactions: UBC;