SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP52859_P050-HRP
Size:100ul
Price: $434.00
SKU
ARP52859_P050-HRP
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.

MTPN Antibody - middle region : HRP (ARP52859_P050-HRP)

Click here to learn more about Aviva's By-Request Conjugation Service.
Datasheets/ManualsPrintable datasheet for anti-MTPN (ARP52859_P050-HRP) antibody
Product Info
Predicted Species ReactivityHuman, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
Product FormatLiquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.
ClonalityPolyclonal
HostRabbit
ConjugationHRP: Horseradish Peroxidase
ApplicationWB
Reconstitution and StorageAll conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MTPN
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Peptide SequenceSynthetic peptide located within the following region: GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV
Concentration0.5 mg/ml
Blocking PeptideFor anti-MTPN (ARP52859_P050-HRP) antibody is Catalog # AAP52859 (Previous Catalog # AAPP33916)
ReferenceXiong,Z., (2006) J. Immunol. 177 (7), 4907-4916
Publications

Nghiem, P. P. et al. Sparing of the dystrophin-deficient cranial sartorius muscle is associated with classical and novel hypertrophy pathways in GRMD dogs. Am. J. Pathol. 183, 1411-24 (2013). IHC, Horse, Rabbit, Rat, Guinea pig, Human, Mouse, Bovine, Dog, Zebrafish 24160322

Gene SymbolMTPN
Gene Full NameMyotrophin
Alias SymbolsV-1, GCDP
NCBI Gene Id136319
Protein NameMyotrophin
Description of TargetMTPN has a potential role in cerebellar morphogenesis. MTPN may function in differentiation of cerebellar neurons, particularly of granule cells. MTPN seems to be associated with cardiac hypertrophy.The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease.
Uniprot IDP58546
Protein Accession #NP_665807
Nucleotide Accession #NM_145808
Protein Size (# AA)118
Molecular Weight13kDa
Protein InteractionsRBBP4; RAB1A; PTPN11; OXCT1; MTAP; PDIA3; ATP6V1A; UBC; NPLOC4; ELAVL1; MAPK1; CAPZB; RELA; NFKB1; REL; DSTYK;
  1. What is the species homology for "MTPN Antibody - middle region : HRP (ARP52859_P050-HRP)"?

    The tested species reactivity for this item is "". This antibody is predicted to have homology to "Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish".

  2. How long will it take to receive "MTPN Antibody - middle region : HRP (ARP52859_P050-HRP)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MTPN Antibody - middle region : HRP (ARP52859_P050-HRP)" provided in?

    This item is provided in "Liquid. Purified antibody is supplied in high phosphate PBS, 100 mm phosphate, 150 mM NaCl, pH 7.6.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MTPN Antibody - middle region : HRP (ARP52859_P050-HRP)"?

    This target may also be called "V-1, GCDP" in publications.

  5. What is the shipping cost for "MTPN Antibody - middle region : HRP (ARP52859_P050-HRP)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MTPN Antibody - middle region : HRP (ARP52859_P050-HRP)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MTPN Antibody - middle region : HRP (ARP52859_P050-HRP)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "13kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MTPN Antibody - middle region : HRP (ARP52859_P050-HRP)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MTPN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MTPN"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MTPN"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MTPN"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MTPN"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MTPN"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MTPN Antibody - middle region : HRP (ARP52859_P050-HRP)
Your Rating
We found other products you might like!