Size:100 ul
Special Price $229.00 Regular Price $319.00
In stock
SKU
ARP52859_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP52859_P050-FITC Conjugated

ARP52859_P050-HRP Conjugated

ARP52859_P050-Biotin Conjugated

MTPN Antibody - middle region (ARP52859_P050)

Catalog#: ARP52859_P050
Domestic: within 1-2 days delivery International: 1-2 days
Click here to learn more about Aviva's By-Request Conjugation Service.
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MTPN
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 86%
Complete computational species homology dataAnti-MTPN (ARP52859_P050)
Peptide SequenceSynthetic peptide located within the following region: GRKPLHYAADCGQLEILEFLLLKGADINAPDKHHITPLLSAVYEGHVSCV
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MTPN (ARP52859_P050) antibody is Catalog # AAP52859 (Previous Catalog # AAPP33916)
Datasheets/ManualsPrintable datasheet for anti-MTPN (ARP52859_P050) antibody
Target ReferenceXiong,Z., (2006) J. Immunol. 177 (7), 4907-4916
Publications

Nghiem, P. P. et al. Sparing of the dystrophin-deficient cranial sartorius muscle is associated with classical and novel hypertrophy pathways in GRMD dogs. Am. J. Pathol. 183, 1411-24 (2013). WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rabbit, Rat, Zebrafish 24160322

Gene SymbolMTPN
Official Gene Full NameMyotrophin
Alias SymbolsFLJ31098, GCDP, V-1
NCBI Gene Id136319
Protein NameMyotrophin
Description of TargetMTPN has a potential role in cerebellar morphogenesis. MTPN may function in differentiation of cerebellar neurons, particularly of granule cells. MTPN seems to be associated with cardiac hypertrophy.The transcript produced from this gene is bi-cistronic and can encode both myotrophin and leucine zipper protein 6. The myotrophin protein is associated with cardiac hypertrophy, where it is involved in the conversion of NFkappa B p50-p65 heterodimers to p50-p50 and p65-p65 homodimers. This protein also has a potential function in cerebellar morphogenesis, and it may be involved in the differentiation of cerebellar neurons, particularly of granule cells. A cryptic ORF at the 3' end of this transcript uses a novel internal ribosome entry site and a non-AUG translation initiation codon to produce leucine zipper protein 6, a 6.4 kDa tumor antigen that is associated with myeloproliferative disease.
Swissprot IdP58546
Protein Accession #NP_665807
Nucleotide Accession #NM_145808
Protein Size (# AA)118
Molecular Weight13kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MTPN.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MTPN.
Protein InteractionsRBBP4; RAB1A; PTPN11; OXCT1; MTAP; PDIA3; ATP6V1A; UBC; NPLOC4; ELAVL1; MAPK1; CAPZB; RELA; NFKB1; REL; DSTYK;
Write Your Own Review
You're reviewing:MTPN Antibody - middle region (ARP52859_P050)
Your Rating
Aviva Tissue Tool
Aviva ChIP Antibodies
Aviva Live Chat
Assay Development