Search Antibody, Protein, and ELISA Kit Solutions

MTO1 Antibody - C-terminal region (ARP74651_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Tested Species Reactivity:
Predicted Species Reactivity:
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Gene Symbol:
Official Gene Full Name:
mitochondrial tRNA translation optimization 1
NCBI Gene Id:
Protein Name:
protein MTO1 homolog, mitochondrial
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
CGI-02, COXPD10,
Replacement Item:
This antibody may replace item sc-161114 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a mitochondrial protein thought to be involved in mitochondrial tRNA modification. The encoded protein may also play a role in the expression of the non-syndromic and aminoglycoside-induced deafness phenotypes associated with a specific mutation in the mitochondrial 12S rRNA gene. Multiple transcript variants encoding different isoforms have been found for this gene.
Protein Size (# AA):
Molecular Weight:
65 kDa
Affinity purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MTO1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MTO1.
The immunogen is a synthetic peptide directed towards the C terminal region of human MTO1
Peptide Sequence:
Synthetic peptide located within the following region: HFSRPQTIGAASRIPGVTPAAIINLLRFVKTTQRRQSAMNESSKTDQYLC
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MTO1 (ARP74651_P050) antibody is Catalog # AAP74651
Printable datasheet for anti-MTO1 (ARP74651_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...