SAVE NOW with 10% off all Recombinant Antibodies Shop Now

Catalog No: ARP84723_P050
Price: $0.00
SKU
ARP84723_P050
Availability: Domestic: within 24 hours delivery | International: 3-5 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MTMR2 (ARP84723_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MTMR2
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: QAIMDSNAQSHKIFIFDARPSVNAVANKAKGGGYESEDAYQNAELVFLDI
Concentration0.5 mg/ml
Blocking PeptideFor anti-MTMR2 (ARP84723_P050) antibody is Catalog # AAP84723
Gene SymbolMTMR2
Gene Full Namemyotubularin related protein 2
Alias SymbolsCMT4B, CMT4B1
NCBI Gene Id8898
Protein Namemyotubularin-related protein 2
Description of TargetThis gene is a member of the myotubularin family of phosphoinositide lipid phosphatases. The encoded protein possesses phosphatase activity towards phosphatidylinositol-3-phosphate and phosphatidylinositol-3,5-bisphosphate. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4B, an autosomal recessive demyelinating neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene.
Uniprot IDQ13614-2
Protein Accession #NP_001230500.1
Nucleotide Accession #NM_001243571.1
Protein Size (# AA)571
Molecular Weight62 kDa
  1. What is the species homology for "MTMR2 Antibody - middle region (ARP84723_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human".

  2. How long will it take to receive "MTMR2 Antibody - middle region (ARP84723_P050)"?

    This item is available "Domestic: within 24 hours delivery | International: 3-5 days".

  3. What buffer format is "MTMR2 Antibody - middle region (ARP84723_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MTMR2 Antibody - middle region (ARP84723_P050)"?

    This target may also be called "CMT4B, CMT4B1" in publications.

  5. What is the shipping cost for "MTMR2 Antibody - middle region (ARP84723_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MTMR2 Antibody - middle region (ARP84723_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MTMR2 Antibody - middle region (ARP84723_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "62 kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MTMR2 Antibody - middle region (ARP84723_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MTMR2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MTMR2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MTMR2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MTMR2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MTMR2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MTMR2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MTMR2 Antibody - middle region (ARP84723_P050)
Your Rating
We found other products you might like!