Aviva Systems Biology office will be closed for Good Friday - April 19, 2019.
Please go here for more info.

Search Antibody, Protein, and ELISA Kit Solutions

MTMR2 Antibody - C-terminal region : FITC (ARP75225_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP75225_P050 Unconjugated

ARP75225_P050-HRP Conjugated

ARP75225_P050-Biotin Conjugated

Gene Symbol:
MTMR2
NCBI Gene Id:
8898
Swissprot Id:
Q13614
Alias Symbols:
MTMR2, KIAA1073,
Replacement Item:
This antibody may replace item sc-271607 from Santa Cruz Biotechnology.
Description of Target:
This gene is a member of the myotubularin family of phosphoinositide lipid phosphatases. The encoded protein possesses phosphatase activity towards phosphatidylinositol-3-phosphate and phosphatidylinositol-3,5-bisphosphate. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4B, an autosomal recessive demyelinating neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene.
Protein Size (# AA):
643
Molecular Weight:
70kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MTMR2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MTMR2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MTMR2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: RHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISN
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
1 mg/ml
Protein Interactions:
UBC; LRSAM1; CTPS2; EHD4; SZRD1; PLIN3; XPNPEP1; HSF1; SNTA1; RFC5; ELAVL1; SBF1; MTMR2; NEFL;
Blocking Peptide:
For anti-MTMR2 (ARP75225_P050-FITC) antibody is Catalog # AAP75225
Datasheets/Manuals:
Printable datasheet for anti-MTMR2 (ARP75225_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...