MTMR2 Antibody - C-terminal region : Biotin (ARP75225_P050-Biotin)

Catalog No: ARP75225_P050-Biotin

Size:100ul

Product Info

• Predicted Species Reactivity: Human
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C-terminal region of Human MTMR2
• Purification: Affinity purified
• Peptide Sequence: Synthetic peptide located within the following region: RHLELWVGYYIRWNPRMKPQEPIHNRYKELLAKRAELQKKVEELQREISN
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MTMR2 (ARP75225_P050-Biotin) antibody is Catalog # AAP75225
• Reference: N/A

Target Info

• Gene Symbol: MTMR2
• Alias Symbols: CMT4B, CMT4B1
• NCBI Gene Id: 8898
• Description of Target: This gene is a member of the myotubularin family of phosphoinositide lipid phosphatases. The encoded protein possesses phosphatase activity towards phosphatidylinositol-3-phosphate and phosphatidylinositol-3,5-bisphosphate. Mutations in this gene are a cause of Charcot-Marie-Tooth disease type 4B, an autosomal recessive demyelinating neuropathy. Alternatively spliced transcript variants encoding multiple isoforms have been found for this gene.
• Uniprot ID: Q13614
• Protein Size (# AA): 643
• Molecular Weight: 70kDa
• Protein Interactions: UBC; LRSAM1; CTPS2; EHD4; SZRD1; PLIN3; XPNPEP1; HSF1; SNTA1; RFC5; ELAVL1; SBF1; MTMR2; NEFL;