MTHFS Recombinant Protein (Human) (OPCA01739)

Catalog No: OPCA01739

MTHFS Recombinant Protein (Human) (OPCA01739) in SDS-PAGE showing the molecular weight of approximately 39.11 kDa.

Product Info

• Predicted Species Reactivity: Homo sapiens|Human
• Product Format: Liquid or Lyophilized powder
• Host: Human
• Additional Information: Relevance: Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) to yield 5,10-methenyltetrahydrofolate.
• Reconstitution and Storage: -20°C or -80°C
• Formulation: 20 mM Tris-HCl based buffer, pH 8.0
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: AAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA
• Protein Sequence: AAAAVSSAKRSLRGELKQRLRAMSAEERLRQSRVLSQKVIAHSEYQKSKRISIFLSMQDEIETEEIIKDIFQRGKICFIPRYRFQSNHMDMVRIESPEEISLLPKTSWNIPQPGEGDVREEALSTGGLDLIFMPGLGFDKHGNRLGRGKGYYDAYLKRCLQHQEVKPYTLALAFKEQICLQVPVNENDMKVDEVLYEDSSTA
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 2-203 aa
• Tag: N-terminal 6xHis-SUMO-tagged

Target Info

• Reference: An enzyme assisted RP-RPLC approach for in-depth analysis of human liver phosphoproteome.Bian Y., Song C., Cheng K., Dong M., Wang F., Huang J., Sun D., Wang L., Ye M., Zou H.J. Proteomics 96:253-262(2014)
• Gene Symbol: MTHFS
• Gene Full Name: methenyltetrahydrofolate synthetase
• Alias Symbols: 5,10-methenyl-tetrahydrofolate synthetase;5,10-methenyltetrahydrofolate synthetase (5-formyltetrahydrofolate cyclo-ligase);5-formyltetrahydrofolate cyclo-ligase;HsT19268;methenyl-THF synthetase;NEDMEHM.
• NCBI Gene Id: 10588
• Protein Name: 5-formyltetrahydrofolate cyclo-ligase
• Description of Target: Contributes to tetrahydrofolate metabolism. Helps regulate carbon flow through the folate-dependent one-carbon metabolic network that supplies carbon for the biosynthesis of purines, thymidine and amino acids. Catalyzes the irreversible conversion of 5-formyltetrahydrofolate (5-FTHF) to yield 5,10-methenyltetrahydrofolate.
• Uniprot ID: P49914
• Protein Accession #: NP_001186687.1
  
• Nucleotide Accession #: NM_001199758.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 39.1 kDa