MTHFD1 Antibody - N-terminal region (ARP46146_P050)

Catalog No: ARP46146_P050

WB Suggested Anti-MTHFD1 Antibody Titration: 0.2-1 ug/ml
ELISA Titer: 1:12500
Positive Control: HepG2 cell lysateMTHFD1 is supported by BioGPS gene expression data to be expressed in HepG2

Liver

Product Info

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit, Zebrafish
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Additional Information: IHC Information: Paraffin embedded liver tissue, tested with an antibody dilution of 5 ug/ml.
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Immunogen: The immunogen is a synthetic peptide directed towards the N terminal region of human MTHFD1
• Purification: Affinity Purified
• Predicted Homology Based on Immunogen Sequence: Cow: 92%; Dog: 92%; Guinea Pig: 92%; Horse: 92%; Human: 100%; Mouse: 100%; Rabbit: 85%; Rat: 100%; Zebrafish: 85%
• Peptide Sequence: Synthetic peptide located within the following region: RTTTESEVMKYITSLNEDSTVHGFLVQLPLDSENSINTEEVINAIAPEKD
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MTHFD1 (ARP46146_P050) antibody is Catalog # AAP46146 (Previous Catalog # AAPP26941)
• Sample Type Confirmation:

  MTHFD1 is supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Palmieri,A., Ann. Hum. Genet. 72 (PT 3), 297-299 (2008)

Target Info

• Gene Symbol: MTHFD1
• Gene Full Name: Methylenetetrahydrofolate dehydrogenase (NADP+ dependent) 1, methenyltetrahydrofolate cyclohydrolase, formyltetrahydrofolate synthetase
• Alias Symbols: CIMAH, MTHFC, MTHFD
• NCBI Gene Id: 4522
• Protein Name: C-1-tetrahydrofolate synthase, cytoplasmic
• Description of Target: MTHFD1 possesses three distinct enzymatic activities, 5,10-methylenetetrahydrofolate dehydrogenase, 5,10-methenyltetrahydrofolate cyclohydrolase and 10-formyltetrahydrofolate synthetase. Each of these activities catalyzes one of three sequential reactions in the interconversion of 1-carbon derivatives of tetrahydrofolate, which are substrates for methionine, thymidylate, and de novo purine syntheses. The trifunctional enzymatic activities are conferred by two major domains, an aminoterminal portion containing the dehydrogenase and cyclohydrolase activities and a larger synthetase domain.This gene encodes a protein that possesses three distinct enzymatic activities, 5,10-methylenetetrahydrofolate dehydrogenase, 5,10-methenyltetrahydrofolate cyclohydrolase and 10-formyltetrahydrofolate synthetase. Each of these activities catalyzes one of three sequential reactions in the interconversion of 1-carbon derivatives of tetrahydrofolate, which are substrates for methionine, thymidylate, and de novo purine syntheses. The trifunctional enzymatic activities are conferred by two major domains, an aminoterminal portion containing the dehydrogenase and cyclohydrolase activities and a larger synthetase domain. Publication Note: This RefSeq record includes a subset of the publications that are available for this gene. Please see the Entrez Gene record to access additional publications.
• Uniprot ID: P11586
• Protein Accession #: NP_005947
• Nucleotide Accession #: NM_005956
• Protein Size (# AA): 935
• Molecular Weight: 101kDa
• Protein Interactions: UBC; FUS; SUMO2; SUMO3; NEDD8; MDM2; RPA3; RPA2; RPA1; RNF2; RPS21; MAT2A; UBQLN1; FBXO6; UBD; ADRB2; CD81; VCAM1; HSP90AA1; HSP90AB1; PRKCDBP; SFXN1; TMEM165; IARS2; SARS2; SF3B3; FAF2; PPT2; SNRNP70; RPL32; MRPL23; ALDH18A1; PRPH; PC; ICT1; GAA; ACSL3;