Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP62285_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP62285_P050-FITC Conjugated

ARP62285_P050-HRP Conjugated

ARP62285_P050-Biotin Conjugated

MTG1 Antibody - N-terminal region (ARP62285_P050)

Catalog#: ARP62285_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityCow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement ItemThis antibody may replace item sc-160545 from Santa Cruz Biotechnology.
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceCow: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 79%; Rat: 86%
Complete computational species homology dataAnti-MTG1 (ARP62285_P050)
Peptide SequenceSynthetic peptide located within the following region: IMQHLEGEGLKNVIFTNCVKDENVKQIIPMVTELIGRSHRYHRKENLEYC
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MTG1 (ARP62285_P050) antibody is Catalog # AAP62285
Datasheets/ManualsPrintable datasheet for anti-MTG1 (ARP62285_P050) antibody
Gene SymbolMTG1
Official Gene Full NameMitochondrial GTPase 1 homolog (S. cerevisiae)
Alias SymbolsGTP, GTPBP7, RP11-108K14.2
NCBI Gene Id92170
Protein NameMitochondrial GTPase 1
Description of TargetMTG1 is a mitochondrial GTPase. MTG1 may be involved in assembly of the large ribosomal subunit.
Swissprot IdQ9BT17-2
Protein Accession #NP_612393
Nucleotide Accession #NM_138384
Protein Size (# AA)267
Molecular Weight29kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MTG1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MTG1.
Protein InteractionsDOCK8; APP; PRNP; ICT1; STRN4;
Write Your Own Review
You're reviewing:MTG1 Antibody - N-terminal region (ARP62285_P050)
Your Rating
Aviva Pathways
Aviva Blast Tool
Aviva Tips and Tricks
Aviva Tissue Tool