Search Antibody, Protein, and ELISA Kit Solutions

MTG1 Antibody - N-terminal region (ARP62285_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP62285_P050-FITC Conjugated

ARP62285_P050-HRP Conjugated

ARP62285_P050-Biotin Conjugated

Gene Symbol:
MTG1
Official Gene Full Name:
Mitochondrial GTPase 1 homolog (S. cerevisiae)
NCBI Gene Id:
92170
Protein Name:
Mitochondrial GTPase 1
Swissprot Id:
Q9BT17-2
Protein Accession #:
NP_612393
Nucleotide Accession #:
NM_138384
Alias Symbols:
GTP, GTPBP7, RP11-108K14.2
Replacement Item:
This antibody may replace item sc-160545 from Santa Cruz Biotechnology.
Description of Target:
MTG1 is a mitochondrial GTPase. MTG1 may be involved in assembly of the large ribosomal subunit.
Protein Size (# AA):
267
Molecular Weight:
29kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity Purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MTG1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MTG1.
Predicted Species Reactivity:
Cow, Guinea Pig, Horse, Human, Mouse, Pig, Rabbit, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 93%; Guinea Pig: 92%; Horse: 100%; Human: 100%; Mouse: 86%; Pig: 93%; Rabbit: 79%; Rat: 86%
Complete computational species homology data:
Anti-MTG1 (ARP62285_P050)
Peptide Sequence:
Synthetic peptide located within the following region: IMQHLEGEGLKNVIFTNCVKDENVKQIIPMVTELIGRSHRYHRKENLEYC
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
DOCK8; APP; PRNP; ICT1; STRN4;
Blocking Peptide:
For anti-MTG1 (ARP62285_P050) antibody is Catalog # AAP62285
Datasheets/Manuals:
Printable datasheet for anti-MTG1 (ARP62285_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...