MTF1 Antibody - C-terminal region : Biotin (ARP32027_T100-Biotin)

Catalog No: ARP32027_T100-Biotin

Size:100ul

Click here to learn more about Aviva's By-Request Conjugation Service.

Product Info

• Predicted Species Reactivity: Human, Mouse, Rat, Cow, Dog, Guinea Pig, Horse, Rabbit
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer.
• Clonality: Polyclonal
• Host: Rabbit
• Conjugation: Biotin
• Application: WB
• Reconstitution and Storage: All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
• Immunogen: The immunogen is a synthetic peptide directed towards the C terminal region of human MTF1
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 93%; Horse: 100%; Human: 100%; Mouse: 100%; Rabbit: 93%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: QSSLVMGEQNLQWILNGATSSPQNQEQIQQASKVEKVFFTTAVPVASSPG
• Concentration: 0.5 mg/ml
• Blocking Peptide: For anti-MTF1 (ARP32027_T100-Biotin) antibody is Catalog # AAP32027 (Previous Catalog # AAPP02929)
• Sample Type Confirmation:

  MTF1 is supported by BioGPS gene expression data to be expressed in HepG2

• Reference: Chen,X., et al., (2004) J. Biol. Chem. 279 (6), 4515-4522

Target Info

• Gene Symbol: MTF1
• Gene Full Name: Metal-regulatory transcription factor 1
• Alias Symbols: ZRF, MTF-1
• NCBI Gene Id: 4520
• Protein Name: Metal regulatory transcription factor 1
• Description of Target: The zinc finger transcription factor MTF-1 (metal-responsive transcription factor-1) is conserved from insects to vertebrates. The major role of MTF-1 in both organisms is to control the transcription of genes involved in the homeostasis and detoxification of heavy metal ions such as Cu2+, Zn2+ and Cd2+. In mammals, MTF-1 serves at least two additional roles. First, targeted disruption of the MTF-1 gene results in death at embryonic day 14 due to liver degeneration, revealing a stage-specific developmental role. Second, under hypoxic-anoxic stress, MTF-1 helps to activate the transcription of the gene placental growth factor (PIGF), an angiogenic protein.
• Uniprot ID: Q14872
• Protein Accession #: NP_005946
• Nucleotide Accession #: NM_005955
• Protein Size (# AA): 753
• Molecular Weight: 81kDa
• Protein Interactions: AP1M1; EP300; CREBBP; MT1G;