MTCP1 Antibody (OAAL00203)

Catalog No: OAAL00203

Size:100UG

Western Blot analysis of MTCP1 expression in transfected 293T cell line by MTCP1 monoclonal antibody (M05), clone 1G12.
Lane 1: MTCP1 transfected lysate (Predicted MW: 7.7 KDa).
Lane 2: Non-transfected lysate.

Detection limit for recombinant GST tagged MTCP1 is 0.1 ng/ml as a capture antibody.

Product Info

• Predicted Species Reactivity: Human, Mouse
• Product Format: Liquid
• Clonality: Monoclonal
• Clone: 1G12
• Isotype: IgG2b Kappa
• Host: Mouse
• Application: Enzyme-linked immunosorbent assay|Western blot
• Reconstitution and Storage: Store at -20C or lower. Aliquot to avoid repeated freezing and thawing.
• Immunogen: MTCP1 (AAH02600, 1 a.a. ~ 68 a.a) full-length recombinant protein with GST tag. MW of the GST tag alone is 26 KDa.
• Peptide Sequence: MPQKDPCQKQACEIQKCLQANSYMESKCQAVIQELRKCCAQYPKGRSVVCSGFEKEEEENLTRKSASK
• Formulation: In 1x PBS, pH 7.4

Target Info

• Gene Symbol: MTCP1
• Gene Full Name: mature T cell proliferation 1
• Alias Symbols: mature T-cell proliferation-1 type B1;MTCP-1 type B1;P13MTCP1;p8MTCP1;protein p13 MTCP-1;TCL1 family AKT coactivator C;TCL1C.
• NCBI Gene Id: 4515
• Protein Name: Homo sapiens mature T-cell proliferation 1, mRNA (cDNA clone MGC:2069 IMAGE:3161408), complete cds|Mature T-cell proliferation 1 [Homo sapiens]
• Description of Target: This gene was identified by involvement in some t(X;14) translocations associated with mature T-cell proliferations. This region has a complex gene structure, with a common promoter and 5' exon spliced to two different sets of 3' exons that encode two different proteins. This gene represents the upstream 13 kDa protein that is a member of the TCL1 family. This protein may be involved in leukemogenesis. [provided by RefSeq
• Protein Accession #: https://www.ncbi.nlm.nih.gov/protein/AAH02600
• Nucleotide Accession #: https://www.ncbi.nlm.nih.gov/nuccore/BC002600