Search Antibody, Protein, and ELISA Kit Solutions

MTA2 Antibody - C-terminal region : FITC (ARP74648_P050-FITC)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP74648_P050 Unconjugated

ARP74648_P050-HRP Conjugated

ARP74648_P050-Biotin Conjugated

Gene Symbol:
MTA2
NCBI Gene Id:
9219
Swissprot Id:
O94776
Protein Accession #:
NP_004730
Alias Symbols:
MTA2, MTA1L1, PID,
Replacement Item:
This antibody may replace item sc-116480 from Santa Cruz Biotechnology.
Description of Target:
This gene encodes a protein that has been identified as a component of NuRD, a nucleosome remodeling deacetylase complex identified in the nucleus of human cells. It shows a very broad expression pattern and is strongly expressed in many tissues. It may represent one member of a small gene family that encode different but related proteins involved either directly or indirectly in transcriptional regulation. Their indirect effects on transcriptional regulation may include chromatin remodeling. It is closely related to another member of this family, a protein that has been correlated with the metastatic potential of certain carcinomas. These two proteins are so closely related that they share the same types of domains. These domains include two DNA binding domains, a dimerization domain, and a domain commonly found in proteins that methylate DNA. One of the proteins known to be a target protein for this gene product is p53. Deacetylation of p53 is correlated with a loss of growth inhibition in transformed cells supporting a connection between these gene family members and metastasis.
Protein Size (# AA):
668
Molecular Weight:
73kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MTA2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MTA2.
Immunogen:
The immunogen is a synthetic peptide directed towards the C-terminal region of Human MTA2
Predicted Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: KDLVAQAPLKPKTPRGTKTPINRNQLSQNRGLGGIMVKRAYETMAGAGVP
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer.
Reconstitution and Storage:
All conjugated antibodies should be stored in light-protected vials or covered with a light protecting material (i.e. aluminum foil). Conjugated antibodies are stable for at least 12 months at 4C. If longer storage is desired (24 months), conjugates may be diluted with up to 50% glycerol and stored at -20C to -80C. Freezing and thawing conjugated antibodies will compromise enzyme activity as well as antibody binding.
Concentration:
0.5 mg/ml
Protein Interactions:
vpr; SUMO2; SUMO3; DNMT3B; DNMT1; NACC2; ZBTB16; UBC; RARA; ZBTB1; RNF2; GPHN; HNRNPR; TRIM28; PPP4R1; ROCK2; SPAG9; POLR2C; POLR2A; MAP4; RPP25; LSM8; GET4; LARP7; CD2AP; NR3C1; MTOR; EHBP1L1; RABEP2; BRCC3; SMEK1; ZGPAT; HDAC1; HDAC2; CSNK1E; MTA3; UBE3
Blocking Peptide:
For anti-MTA2 (ARP74648_P050-FITC) antibody is Catalog # AAP74648
Datasheets/Manuals:
Printable datasheet for anti-MTA2 (ARP74648_P050-FITC) antibody
Conjugation:
FITC (FAM): Excitation 495 nm/ Emission 520 nm
Target Reference:
N/A

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...