MT2731 Recombinant Protein (Mycobacterium tuberculosis) (OPCA03258)

Catalog No: OPCA03258

MT2731 Recombinant Protein (Mycobacterium tuberculosis) (OPCA03258) in SDS-PAGE showing the molecular weight of approximately 9.7 kDa.

Product Info

• Predicted Species Reactivity: Mycobacterium tuberculosis
• Product Format: Liquid or Lyophilized powder
• Host: Mycobacterium tuberculosis
• Reconstitution and Storage: -20°C or -80°C
• Purification: Affinity purified using IMAC
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP
• Protein Sequence: Full Length: MSGHALAARTLLAAADELVGGPPVEASAAALAGDAAGAWRTAAVELARALVRAVAESHGVAAVLFAATAAAAAAVDRGDPP
• Source: Yeast
• Tag: N-terminal 6xHis-tagged

Target Info

• Reference: Whole-genome comparison of Mycobacterium tuberculosis clinical and laboratory strains.Fleischmann R.D., Alland D., Eisen J.A., Carpenter L., White O., Peterson J.D., DeBoy R.T., Dodson R.J., Gwinn M.L., Haft D.H., Hickey E.K., Kolonay J.F., Nelson W.C., Umayam L.A., Ermolaeva M.D., Salzberg S.L., Delcher A., Utterback T.R. Fraser C.M.J. Bacteriol. 184:5479-5490(2002)
• Gene Symbol: MT2731
• Alias Symbols: MT2731, Antitoxin MT2731
• Protein Name: Antitoxin MT2731
• Description of Target: Antitoxin component of a type II toxin-antitoxin (TA) system. Neutralizes the effect of cognate toxin MT2730 (By similarity).
• Uniprot ID: P9WJ10
• Protein Accession #: WP_003899415.1
  
• Nucleotide Accession #: NZ_KK341227.1
• Protein Size (# AA): Recombinant
• Molecular Weight: 9.7 kDa