Size:100 ul
$229.00
In Stock
SKU
ARP31396_T100
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP31396_T100-FITC Conjugated

ARP31396_T100-HRP Conjugated

ARP31396_T100-Biotin Conjugated

MSX1 Antibody - middle region (ARP31396_T100)

Catalog#: ARP31396_T100
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application IHC, WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-133797 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the middle region of human MSX1
Purification Protein A purified
Predicted Homology Based on Immunogen Sequence Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rat: 100%
Complete computational species homology data Anti-MSX1 (ARP31396_T100)
Peptide Sequence Synthetic peptide located within the following region: SLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MSX1 (ARP31396_T100) antibody is Catalog # AAP31396 (Previous Catalog # AAPP02153)
Datasheets/Manuals Printable datasheet for anti-MSX1 (ARP31396_T100) antibody
Target Reference Djousse,L., et al., (2004) Neurogenetics 5 (2), 109-114
Publications

Mizokami, Y. et al. Expression of MSX1 in human normal pituitaries and pituitary adenomas. Endocr. Pathol. 19, 54-61 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 18379900

Gene Symbol MSX1
Official Gene Full Name Msh homeobox 1
Alias Symbols HOX7, HYD1, STHAG1
NCBI Gene Id 4487
Protein Name Homeobox protein MSX-1
Description of Target Slightly proximal to the Huntington disease locus, the human MSX1 gene is deleted in patients with Wolf-Hirschhorn syndrome. This gene is also called HOX7. The Msx family of vertebrate HOX genes was originally isolated by homology to the Drosophila msh (muscle segment homeo box) gene. This is a candidate gene for human cleft palate.
Swissprot Id P28360
Protein Accession # NP_002439
Nucleotide Accession # NM_002448
Protein Size (# AA) 297
Molecular Weight 31kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MSX1.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MSX1.
Protein Interactions MED19; NMNAT1; ING4; UBC; TLE2; PIAS1; PAX3; TLE4; LHX2; SUMO2; RGS7; SUMO1; TLE1; AES; CREBBP; TBP; TAF1; TP53; SP1; PAX9; POU2F1; MSX1; MSX2; HOXC8; DLX5; DLX2;
  1. What is the species homology for "MSX1 Antibody - middle region (ARP31396_T100)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat".

  2. How long will it take to receive "MSX1 Antibody - middle region (ARP31396_T100)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MSX1 Antibody - middle region (ARP31396_T100)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MSX1 Antibody - middle region (ARP31396_T100)"?

    This target may also be called "HOX7, HYD1, STHAG1" in publications.

  5. What is the shipping cost for "MSX1 Antibody - middle region (ARP31396_T100)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MSX1 Antibody - middle region (ARP31396_T100)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MSX1 Antibody - middle region (ARP31396_T100)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "31kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MSX1 Antibody - middle region (ARP31396_T100)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MSX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MSX1"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MSX1"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MSX1"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MSX1"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MSX1"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MSX1 Antibody - middle region (ARP31396_T100)
Your Rating
We found other products you might like!