Search Antibody, Protein, and ELISA Kit Solutions

MSX1 Antibody - middle region (ARP31396_T100)

100 ul
$229.00
In Stock
Request Bulk Order Quote

Conjugation Options

ARP31396_T100-FITC Conjugated

ARP31396_T100-HRP Conjugated

ARP31396_T100-Biotin Conjugated

Gene Symbol:
MSX1
Official Gene Full Name:
Msh homeobox 1
NCBI Gene Id:
4487
Protein Name:
Homeobox protein MSX-1
Swissprot Id:
P28360
Protein Accession #:
NP_002439
Nucleotide Accession #:
NM_002448
Alias Symbols:
HOX7, HYD1, STHAG1
Replacement Item:
This antibody may replace item sc-133797 from Santa Cruz Biotechnology.
Description of Target:
Slightly proximal to the Huntington disease locus, the human MSX1 gene is deleted in patients with Wolf-Hirschhorn syndrome. This gene is also called HOX7. The Msx family of vertebrate HOX genes was originally isolated by homology to the Drosophila msh (muscle segment homeo box) gene. This is a candidate gene for human cleft palate.
Protein Size (# AA):
297
Molecular Weight:
31kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Protein A purified
Application:
IHC, WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MSX1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MSX1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MSX1
Predicted Species Reactivity:
Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
Tested Species Reactivity:
Human
Predicted Homology Based on Immunogen Sequence:
Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rat: 100%
Complete computational species homology data:
Anti-MSX1 (ARP31396_T100)
Peptide Sequence:
Synthetic peptide located within the following region: SLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
MED19; NMNAT1; ING4; UBC; TLE2; PIAS1; PAX3; TLE4; LHX2; SUMO2; RGS7; SUMO1; TLE1; AES; CREBBP; TBP; TAF1; TP53; SP1; PAX9; POU2F1; MSX1; MSX2; HOXC8; DLX5; DLX2;
Blocking Peptide:
For anti-MSX1 (ARP31396_T100) antibody is Catalog # AAP31396 (Previous Catalog # AAPP02153)
Datasheets/Manuals:
Printable datasheet for anti-MSX1 (ARP31396_T100) antibody
Target Reference:
Djousse,L., et al., (2004) Neurogenetics 5 (2), 109-114
Publications:

Mizokami, Y. et al. Expression of MSX1 in human normal pituitaries and pituitary adenomas. Endocr. Pathol. 19, 54-61 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 18379900

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...