MSX1 Antibody - middle region (ARP31396_T100)

Catalog#: ARP31396_T100

• Size: 100 ul

• Tested Species Reactivity: Human
• Predicted Species Reactivity: Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat
• Product Format: Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
• Clonality: Polyclonal
• Host: Rabbit
• Application: IHC, WB
• Reconstitution and Storage: For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
• Replacement Item: This antibody may replace item sc-133797 from Santa Cruz Biotechnology.
• Immunogen: The immunogen is a synthetic peptide directed towards the middle region of human MSX1
• Purification: Protein A purified
• Predicted Homology Based on Immunogen Sequence: Cow: 100%; Dog: 100%; Guinea Pig: 100%; Horse: 100%; Human: 100%; Mouse: 86%; Rat: 100%
• Peptide Sequence: Synthetic peptide located within the following region: SLGAPDAPSSPRPLGHFSVGGLLKLPEDALVKAESPEKPERTPWMQSPRF
• Concentration: Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
• Blocking Peptide: For anti-MSX1 (ARP31396_T100) antibody is Catalog # AAP31396 (Previous Catalog # AAPP02153)
• Target Reference: Djousse,L., et al., (2004) Neurogenetics 5 (2), 109-114
• Publications:

  Mizokami, Y. et al. Expression of MSX1 in human normal pituitaries and pituitary adenomas. Endocr. Pathol. 19, 54-61 (2008). IHC, WB, Cow, Dog, Guinea Pig, Horse, Human, Mouse, Rat 18379900

• Gene Symbol: MSX1
• Official Gene Full Name: Msh homeobox 1
• Alias Symbols: HOX7, HYD1, STHAG1
• NCBI Gene Id: 4487
• Protein Name: Homeobox protein MSX-1
• Description of Target: Slightly proximal to the Huntington disease locus, the human MSX1 gene is deleted in patients with Wolf-Hirschhorn syndrome. This gene is also called HOX7. The Msx family of vertebrate HOX genes was originally isolated by homology to the Drosophila msh (muscle segment homeo box) gene. This is a candidate gene for human cleft palate.
• Swissprot Id: P28360
• Protein Accession #: NP_002439
• Nucleotide Accession #: NM_002448
• Protein Size (# AA): 297
• Molecular Weight: 31kDa
• RNA Seq: Find tissues and cell lines supported by RNA-seq analysis to express MSX1.
• Protein Interactions: MED19; NMNAT1; ING4; UBC; TLE2; PIAS1; PAX3; TLE4; LHX2; SUMO2; RGS7; SUMO1; TLE1; AES; CREBBP; TBP; TAF1; TP53; SP1; PAX9; POU2F1; MSX1; MSX2; HOXC8; DLX5; DLX2;

Protocol:

• Reconstitution Instructions
• Immunohistochemistry (IHC) Protocol
• Immunocytochemistry (ICC) Protocol
• Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
• Western Blotting/Immunoblotting (WB/IB) Protocol
• Blocking Peptide Competition Protocol (BPCP)
• Immunoprecipitation (IP) Protocol

Tips Information:

• IHC Tips & Tricks
• ICC Tips & Tricks
• ELISA Tips & Tricks
• WB/IB Tips & Tricks
• IP Tips & Tricks

See our General FAQ page.

Product Protocols: MSX1 antibody tested with Human Kidney Tissue (ARP31396_T100)

Product Protocols: MSX1 antibody tested by IHC with human muscle (ARP31396)