Search Antibody, Protein, and ELISA Kit Solutions

MST1 Antibody - middle region (ARP45724_P050)

100 ul
In Stock
Request Bulk Order Quote

Conjugation Options

ARP45724_P050-FITC Conjugated

ARP45724_P050-HRP Conjugated

ARP45724_P050-Biotin Conjugated

Gene Symbol:
Official Gene Full Name:
Macrophage stimulating 1 (hepatocyte growth factor-like)
NCBI Gene Id:
Protein Name:
Hepatocyte growth factor-like protein
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Alias Symbols:
D3F15S2, DNF15S2, HGFL, MSP, NF15S2
Replacement Item:
This antibody may replace item sc-39570, HPA024036
Description of Target:
MST1 belongs to the peptidase S1 family, plasminogen subfamily. It contains 4 kringle domains, 1 PAN domain and 1 peptidase S1 domain. MST1 probably has no proteolytic activity, since crucial characteristic of serine proteases catalytic sites are not conserved.
Protein Size (# AA):
Molecular Weight:
Affinity Purified
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MST1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MST1.
The immunogen is a synthetic peptide directed towards the middle region of human MST1
Predicted Species Reactivity:
Cow, Dog, Horse, Human, Pig, Rabbit
Tested Species Reactivity:
Predicted Homology Based on Immunogen Sequence:
Cow: 77%; Dog: 85%; Horse: 85%; Human: 100%; Pig: 86%; Rabbit: 86%
Complete computational species homology data:
Anti-MST1 (ARP45724_P050)
Peptide Sequence:
Synthetic peptide located within the following region: SCHMPLTGYEVWLGTLFQNPQHGEPSLQRVPVAKMVCGPSGSQLVLLKLE
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Protein Interactions:
Blocking Peptide:
For anti-MST1 (ARP45724_P050) antibody is Catalog # AAP45724 (Previous Catalog # AAPP11857)
Printable datasheet for anti-MST1 (ARP45724_P050) antibody
Target Reference:
Fisher,S.A., (er) Nat. Genet. (2008) In press

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...