MSRB7 Recombinant Protein (Mouse-ear cress) (OPCA04549)

Catalog No: OPCA04549

Product Info

• Predicted Species Reactivity: Arabidopsis thaliana
• Product Format: Liquid or Lyophilized powder
• Additional Information: Species Specificity Detail: Arabidopsis thaliana (Mouse-ear cress)
• Reconstitution and Storage: -20°C or -80°C
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Peptide Sequence: MAAMTAAAVPATGSFQKQDEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGWPAFFDAIPGAIKQTPEAGGRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSLKFSSAGSSQ
• Protein Sequence: MAAMTAAAVPATGSFQKQDEEWRAVLSPEQFRVLRLKGTDKRGKGEFTKKFEEGTYSCAGCGTALYKSTTKFDSGCGWPAFFDAIPGAIKQTPEAGGRRMEITCAVCDGHLGHVFKGEGYSTPTDQRHCVNSVSLKFSSAGSSQ
• Storage Buffer: If the delivery form is liquid, the default storage buffer is Tris/PBS-based buffer, 5%-50% glycerol. If the delivery form is lyophilized powder, the buffer before lyophilization is Tris/PBS-based buffer, 6% Trehalose, pH 8.0.
• Source: E.coli
• Protein Range: 1-144 aa
• Tag: N-terminal 6xHis-SUMO-tagged
• Reference: Sequence and analysis of chromosome 4 of the plant Arabidopsis thaliana.Mayer K.F.X., Schueller C., Wambutt R., Murphy G., Volckaert G., Pohl T., Duesterhoeft A., Stiekema W., Entian K.-D., Terryn N., Harris B., Ansorge W., Brandt P., Grivell L.A., Rieger M., Weichselgartner M., de Simone V., Obermaier B. McCombie W.R.Nature 402:769-777(1999)

Target Info

• Gene Symbol: MSRB7
• Gene Full Name: methionine sulfoxide reductase B7
• Alias Symbols: AT4G21830;ATMSRB7;methionine sulfoxide reductase B7;Peptide-methionine (R)-S-oxide reductase;T8O5.40;T8O5_40.
• NCBI Gene Id: 828271
• Protein Name: Peptide methionine sulfoxide reductase B7
• Description of Target: Catalyzes the reduction of methionine sulfoxide (MetSO) to methionine in proteins. Plays a protective role against oxidative stress by restoring activity to proteins that have been inactivated by methionine oxidation. MSRB family specifically reduces the MetSO R-enantiomer (By similarity).
• Uniprot ID: Q8VY86
• Protein Size (# AA): Recombinant
• Molecular Weight: 31.5 kDa