Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP41110_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

Conjugation Options

ARP41110_P050-FITC Conjugated

ARP41110_P050-HRP Conjugated

ARP41110_P050-Biotin Conjugated

MSI2 Antibody - N-terminal region (ARP41110_P050)

Catalog#: ARP41110_P050
Domestic: within 1-2 days delivery | International: 1-2 days
More Information
Tested Species Reactivity Human
Predicted Species Reactivity Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Clonality Polyclonal
Host Rabbit
Application WB
Reconstitution and Storage For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item This antibody may replace item sc-367844 from Santa Cruz Biotechnology.
Immunogen The immunogen is a synthetic peptide directed towards the N terminal region of human MSI2
Purification Affinity Purified
Predicted Homology Based on Immunogen Sequence Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data Anti-MSI2 (ARP41110_P050)
Peptide Sequence Synthetic peptide located within the following region: EANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECM
Concentration Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide For anti-MSI2 (ARP41110_P050) antibody is Catalog # AAP41110 (Previous Catalog # AAPS02408)
Datasheets/Manuals Printable datasheet for anti-MSI2 (ARP41110_P050) antibody
Target Reference Barbouti,A., (2003) Cancer Res. 63 (6), 1202-1206
Publications

Cox, J. L. et al. The SOX2-interactome in brain cancer cells identifies the requirement of MSI2 and USP9X for the growth of brain tumor cells. PLoS One 8, e62857 (2013). WB, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23667531

Gene Symbol MSI2
Official Gene Full Name Musashi homolog 2 (Drosophila)
Alias Symbols FLJ36569, MGC3245, MSI2H
NCBI Gene Id 124540
Protein Name RNA-binding protein Musashi homolog 2
Description of Target MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Two transcript variants encoding distinct isoforms have been identified for this gene.
Swissprot Id Q96DH6
Protein Accession # NP_620412
Nucleotide Accession # NM_138962
Protein Size (# AA) 328
Molecular Weight 35kDa
Tissue Tool Find tissues and cell lines supported by DNA array analysis to express MSI2.
RNA Seq Find tissues and cell lines supported by RNA-seq analysis to express MSI2.
Protein Interactions MEOX2; HNRNPH2; SUMO2; RPA3; RPA2; RPA1; SUZ12; RNF2; BMI1; TARDBP; SOX2; VCAM1; UBC; CUL3; H2AFX; GRB2;
  1. What is the species homology for "MSI2 Antibody - N-terminal region (ARP41110_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Mouse, Pig, Rabbit, Rat, Zebrafish".

  2. How long will it take to receive "MSI2 Antibody - N-terminal region (ARP41110_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MSI2 Antibody - N-terminal region (ARP41110_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MSI2 Antibody - N-terminal region (ARP41110_P050)"?

    This target may also be called "FLJ36569, MGC3245, MSI2H" in publications.

  5. What is the shipping cost for "MSI2 Antibody - N-terminal region (ARP41110_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MSI2 Antibody - N-terminal region (ARP41110_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MSI2 Antibody - N-terminal region (ARP41110_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "35kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MSI2 Antibody - N-terminal region (ARP41110_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data tab on the product page.

  10. What are positive controls for "MSI2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MSI2"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MSI2"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MSI2"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MSI2"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MSI2"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MSI2 Antibody - N-terminal region (ARP41110_P050)
Your Rating
We found other products you might like!