Search Antibody, Protein, and ELISA Kit Solutions

MSI2 Antibody - N-terminal region (ARP41110_P050)

100 ul

Regular Price: $289.00

Special Price: $229.00

In Stock
Request Bulk Order Quote

Conjugation Options

ARP41110_P050-FITC Conjugated

ARP41110_P050-HRP Conjugated

ARP41110_P050-Biotin Conjugated

Tested Species Reactivity:
Predicted Species Reactivity:
Human, Mouse, Pig, Rabbit, Rat, Zebrafish
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Replacement Item:
This antibody may replace item sc-367844 from Santa Cruz Biotechnology.
The immunogen is a synthetic peptide directed towards the N terminal region of human MSI2
Affinity Purified
Predicted Homology Based on Immunogen Sequence:
Human: 100%; Mouse: 100%; Pig: 100%; Rabbit: 100%; Rat: 100%; Zebrafish: 100%
Complete computational species homology data:
Anti-MSI2 (ARP41110_P050)
Peptide Sequence:
Synthetic peptide located within the following region: EANGSQGTSGSANDSQHDPGKMFIGGLSWQTSPDSLRDYFSKFGEIRECM
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MSI2 (ARP41110_P050) antibody is Catalog # AAP41110 (Previous Catalog # AAPS02408)
Printable datasheet for anti-MSI2 (ARP41110_P050) antibody
Target Reference:
Barbouti,A., (2003) Cancer Res. 63 (6), 1202-1206

Cox, J. L. et al. The SOX2-interactome in brain cancer cells identifies the requirement of MSI2 and USP9X for the growth of brain tumor cells. PLoS One 8, e62857 (2013). WB, Human, Mouse, Pig, Rabbit, Rat, Zebrafish 23667531

Gene Symbol:
Official Gene Full Name:
Musashi homolog 2 (Drosophila)
Alias Symbols:
FLJ36569, MGC3245, MSI2H
NCBI Gene Id:
Protein Name:
RNA-binding protein Musashi homolog 2
Description of Target:
MSI2 contains two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. This gene encodes a protein containing two conserved tandem RNA recognition motifs. Similar proteins in other species function as RNA-binding proteins and play central roles in posttranscriptional gene regulation. Two transcript variants encoding distinct isoforms have been identified for this gene.
Swissprot Id:
Protein Accession #:
Nucleotide Accession #:
Protein Size (# AA):
Molecular Weight:
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MSI2.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MSI2.
Protein Interactions:

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...