- Toll Free: 888-880-0001
- Phone: 858-552-6979
- Email: info@avivasysbio.com
- $55: Antibody & Protein in US
- $55 + $25/Kit in US
- Contact us for international orders.
Datasheets/Manuals | Printable datasheet for MSH2 Antibody (OABB01767) |
---|
Tested Species Reactivity | Human, Mouse, Rat |
---|---|
Predicted Species Reactivity | Human|Mouse|Rat |
Product Format | Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Clonality | Polyclonal |
Clone | Polyclonal |
Isotype | Rabbit IgG |
Host | Rabbit |
Application | Flow cytometry|Immunocytochemistry|Immunofluorescence|Immunohistochemistry|Immunohistochemistry-Frozen|Western blot |
Additional Information | Notes: WB: The detection limit for MSH2 is approximately 0.2ng/lane under reducing conditions. Tested Species: In-house tested species with positive results. By Heat: Boiling the paraffin sections in 10mM citrate buffer, pH6.0, for 20mins is required for the staining of formalin/paraffin sections. Other applications have not been tested. Optimal dilutions should be determined by end users. |
:: | Background: DNA mismatch repair protein Msh2, also known as MutS protein homolog 2 or MSH2, is a protein that in humans is encoded by the MSH2 gene, which is located on chromosome 2. MSH2 is a tumor suppressor gene and more specifically a caretaker gene that codes for a DNA mismatch repair (MMR) protein, MSH2 which forms aheterodimer with MSH6 to make the human MutSα mismatch repair complex. It also dimerizes with MSH3 to form the MutSβ DNA repair complex. MSH2 is involved in many different forms of DNA repair, including transcription-coupled repair, homologous recombination, and base excision repair. It has been found that MSH2 may also be a coactivator of ESR1-dependent gene expression. |
Reconstitution and Storage | 2°C to 8°C|-20°C |
Immunogen | E.coli-derived human MSH2 recombinant protein (Position: Q337-N583). Human MSH2 shares 94% and 93% amino acid (aa) sequence identity with mouse and rat MSH2, respectively. |
Purification | Affinity Purified |
Peptide Sequence | Synthetic peptide located within the following region: QGQRLVNQWIKQPLMDKNRIEERLNLVEAFVEDAELRQTLQEDLLRRFPDLNRLAKKFQRQAANLQDCYRLYQGINQLPNVIQALEKHEGKHQKLLLAVFVTPLTDLRSDFSKFQEMIETTLDMDQVENHEFLVKPSFDPNLSELREIMNDLEKKMQSTLISAARDLGLDPGKQIKLDSSAQFGYYFRVTCKEEKVLRNNKNFSTVDIQKNGVKFTNSKLTSLNEEYTKNKTEYEEAQDAIVKEIVN |
Concentration | 500 ug/ml |
Specificity | No cross reactivity with other proteins. |
Application Info | Western blot: 0.1-0.5 ug/ml: Human, Mouse, Rat Immunohistochemistry (Paraffin-embedded Section): 0.5-1 ug/ml: Human, Mouse, Rat: By Heat Immunohistochemistry (Frozen Section): 0.5-1 ug/ml: Human Immunocytochemistry/Immunofluorescence: 2 ug/ml: Human Flow Cytometry: 1-3 ug/1x10^6 cells: Human |
Reference | 1. de Wind N, Dekker M, Berns A, Radman M, te Riele H (July 1995). "Inactivation of the mouse Msh2 gene results in mismatch repair deficiency, methylation tolerance, hyperrecombination, and predisposition to cancer". Cell 82 (2): 321–30. 2. Mellon I, Rajpal DK, Koi M, Boland CR, Champe GN (April 1996). "Transcription-coupled repair deficiency and mutations in human mismatch repair genes". Science 272 (5261): 557–60. 3. Wada-Hiraike, O., Yano, T., Nei, T., Matsumoto, Y., Nagasaka, K., Takizawa, S., Oishi, H., Arimoto, T., Nakagawa, S., Yasugi, T., Kato, S., Taketani, Y. The DNA mismatch repair gene hMSH2 is a potent coactivator of oestrogen receptor-alpha. Brit. J. Cancer 92: 2286-2291, 2005. |
Storage Buffer | Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3. |
Description | Rabbit IgG polyclonal antibody for DNA mismatch repair protein Msh2(MSH2) detection. Tested with WB, IHC-P, IHC-F, ICC/IF, FCM in Human;Mouse;Rat. |
Gene Symbol | MSH2 |
---|---|
Gene Full Name | mutS homolog 2 |
Alias Symbols | COCA1;DNA mismatch repair protein Msh2;DNA mismatch repair protein Msh2 transcript;FCC1;hMSH2;HNPCC;HNPCC1;LCFS2;MMRCS2;mutS homolog 2, colon cancer, nonpolyposis type 1;MutS protein homolog 2. |
NCBI Gene Id | 4436 |
Protein Name | DNA mismatch repair protein Msh2 |
Description of Target | Component of the post-replicative DNA mismatch repair system (MMR). Forms two different heterodimers: MutS alpha (MSH2-MSH6 heterodimer) and MutS beta (MSH2-MSH3 heterodimer) which binds to DNA mismatches thereby initiating DNA repair. When bound, heterodimers bend the DNA helix and shields approximately 20 base pairs. MutS alpha recognizes single base mismatches and dinucleotide insertion-deletion loops (IDL) in the DNA. MutS beta recognizes larger insertion-deletion loops up to 13 nucleotides long. After mismatch binding, MutS alpha or beta forms a ternary complex with the MutL alpha heterodimer, which is thought to be responsible for directing the downstream MMR events, including strand discrimination, excision, and resynthesis. Recruits DNA helicase MCM9 to chromatin which unwinds the mismatch containg DNA strand (PubMed:26300262). ATP binding and hydrolysis play a pivotal role in mismatch repair functions. The ATPase activity associated with MutS alpha regulates binding similar to a molecular switch: mismatched DNA provokes ADP-->ATP exchange, resulting in a discernible conformational transition that converts MutS alpha into a sliding clamp capable of hydrolysis-independent diffusion along the DNA backbone. This transition is crucial for mismatch repair. MutS alpha may also play a role in DNA homologous recombination repair. In melanocytes may modulate both UV-B-induced cell cycle regulation and apoptosis. |
Uniprot ID | P43246 |
Molecular Weight | 104743 MW |
- Protocol:
- Reconstitution & Storage Instructions
- Western Blotting/Immunoblotting (WB/IB) Protocol
- Immunohistochemistry (IHC) Protocol
- Immunocytochemistry (ICC) Protocol
- Enzyme-Linked ImmunoSorbent Assay (ELISA) Protocol
- Blocking Peptide Competition Protocol (BPCP)
- Immunoprecipitation (IP) Protocol
- Antibody Array (AA) Protocol
- Tips Information:
-
See our General FAQ page.
-
What is the species homology for "MSH2 Antibody (OABB01767)"?
The tested species reactivity for this item is "Human, Mouse, Rat". This antibody is predicted to have homology to "Human|Mouse|Rat".
-
How long will it take to receive "MSH2 Antibody (OABB01767)"?
This item is available "Domestic: within 1-2 week delivery | International: within 1-2 week delivery".
-
What buffer format is "MSH2 Antibody (OABB01767)" provided in?
This item is provided in "Lyophilized. Each vial contains 5mg BSA, 0.9mg NaCl, 0.2mg Na2HPO4, 0.05mg NaN3.".
Additional format options may be available. For more information please contact info@avivasysbio.com. -
What are other names for "MSH2 Antibody (OABB01767)"?
This target may also be called "COCA1;DNA mismatch repair protein Msh2;DNA mismatch repair protein Msh2 transcript;FCC1;hMSH2;HNPCC;HNPCC1;LCFS2;MMRCS2;mutS homolog 2, colon cancer, nonpolyposis type 1;MutS protein homolog 2." in publications.
-
What is the shipping cost for "MSH2 Antibody (OABB01767)"?
The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.
-
What is the guarantee for "MSH2 Antibody (OABB01767)"?
All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.
-
Can I get bulk pricing for "MSH2 Antibody (OABB01767)"?
You can get bulk pricing for this item by going here.
-
What is the molecular weight of the protein?
The molecular weight reported by Uniprot for this item is "104743 MW".
Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics. -
What protocols are available for "MSH2 Antibody (OABB01767)"?
We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.
-
What are positive controls for "MSH2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What are negative controls for "MSH2"?
We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.
-
What other proteins interact with "MSH2"?
This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.
-
What biological processes are associated with "MSH2"?
This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.
-
What cellular components are associated with "MSH2"?
This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.
-
What protein functions are associated with "MSH2"?
This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.