MSA2 Recombinant Protein (Plasmodium falciparum) (OPCA04148)

Catalog No: OPCA04148

Product Info

• Predicted Species Reactivity: Plasmodium falciparum
• Product Format: Liquid
• Additional Information: Species Specificity Detail: Plasmodium falciparum (isolate 3D7)
• Reconstitution and Storage: Briefly centrifuge lyophilized product prior to opening to bring the contents to the bottom. Please reconstitute protein to 0.1-1.0 mg/mL by adding deionized sterile water first, followed by addition of glycerol to a final concentration of 5-50%. Reconstituted product should be aliquoted for long-term storage at -20C/-80C. Our in house default final concentration of glycerol is 50% for reference. The shelf life is related to many factors, storage state, buffer ingredients, storage temperature and the stability of the protein itself. Generally, the shelf life of liquid form is 6 months at -20C/-80C. The shelf life of lyophilized form is 12 months at -20C/-80C. Repeated freezing and thawing is not recommended. Store working aliquots at 4C for up to one week.
• Formulation: Tris-base, 50% glycerol
• Purity: Greater than 90% as determined by SDS-PAGE.
• Protein Sequence: Partial: NDAEASTSTSSENPNHKNAETNPKGKGEVQEPNQANKETQNNSNVQQDSQTKSNVPPTQDADTKSPTAQPEQAENSAPTAEQTESPELQSAPENKGTGQHGHMHGSRNNHPQNTSDSQKECTDGNKENCGAATSLLNN
• Storage Buffer: Tris-base, 50% glycerol
• Source: Yeast
• Tag: N-terminal 6xHis-tagged
• Reference: Structural diversity in the 45-kilodalton merozoite surface antigen of Plasmodium falciparum.Smythe J.A., Peterson M.G., Coppel R.L., Saul A.J., Kemp D.J., Anders R.F.Mol. Biochem. Parasitol. 39:227-234(1990)

Target Info

• Gene Symbol: MSA2
• Alias Symbols: 45 kDa merozoite surface antigen
• NCBI Gene Id: 812660
• Protein Name: Merozoite surface antigen 2
• Description of Target: May play a role in the merozoite attachment to the erythrocyte.
• Uniprot ID: P50498
• Protein Accession #: XP_001349578
• Nucleotide Accession #: XM_001349542
• Molecular Weight: 17 kDa