Loading...
Catalog No: ARP58497_P050
Price: $0.00
SKU
ARP58497_P050
Availability: Domestic: within 1-2 days delivery | International: 1-2 days
Bulk
Order
Aviva's
Satisfaction
Guarantee
Contact Us:
Shipping Info:
  • $55: Antibody & Protein in US
  • $55 + $25/Kit in US
  • Contact us for international orders.
Datasheets/ManualsPrintable datasheet for anti-MS4A4A (ARP58497_P050) antibody
Product Info
Tested Species ReactivityHuman
Predicted Species ReactivityHuman, Rat
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the N terminal region of human MS4A4A
PurificationAffinity Purified
Predicted Homology Based on Immunogen SequenceHuman: 100%; Rat: 86%
Peptide SequenceSynthetic peptide located within the following region: MHQTYSRHCRPEESTFSAAMTTMQGMEQAMPGAGPGVPQLGNMAVIHSHL
Concentration0.5 mg/ml
Blocking PeptideFor anti-MS4A4A (ARP58497_P050) antibody is Catalog # AAP58497 (Previous Catalog # AAPP34843)
ReferenceLiang,Y., (2001) Immunogenetics 53 (5), 357-368
Gene SymbolMS4A4A
Gene Full NameMembrane-spanning 4-domains, subfamily A, member 4A
Alias SymbolsMS4A4, MS4A7, 4SPAN1, CD20L1, CD20-L1, HDCME31P
NCBI Gene Id51338
Protein NameMembrane-spanning 4-domains subfamily A member 4A
Description of TargetMS4A4A is a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues.This gene encodes a member of the membrane-spanning 4A gene family. Members of this nascent protein family are characterized by common structural features and similar intron/exon splice boundaries and display unique expression patterns among hematopoietic cells and nonlymphoid tissues. Alternative splicing of this gene results in several transcript variants; however, not all transcripts have been fully described.
Uniprot IDQ96JQ5
Protein Accession #NP_683876
Nucleotide Accession #NM_148975
Protein Size (# AA)239
Molecular Weight26kDa
  1. What is the species homology for "MS4A4A Antibody - N-terminal region (ARP58497_P050)"?

    The tested species reactivity for this item is "Human". This antibody is predicted to have homology to "Human, Rat".

  2. How long will it take to receive "MS4A4A Antibody - N-terminal region (ARP58497_P050)"?

    This item is available "Domestic: within 1-2 days delivery | International: 1-2 days".

  3. What buffer format is "MS4A4A Antibody - N-terminal region (ARP58497_P050)" provided in?

    This item is provided in "Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.".
    Additional format options may be available. For more information please contact info@avivasysbio.com.

  4. What are other names for "MS4A4A Antibody - N-terminal region (ARP58497_P050)"?

    This target may also be called "MS4A4, MS4A7, 4SPAN1, CD20L1, CD20-L1, HDCME31P" in publications.

  5. What is the shipping cost for "MS4A4A Antibody - N-terminal region (ARP58497_P050)"?

    The shipping cost for this item is $40 within the US. Please contact us for specific shipping prices for international orders.

  6. What is the guarantee for "MS4A4A Antibody - N-terminal region (ARP58497_P050)"?

    All Aviva products have been through rigorous validations and carry 100% satisfaction guarantee.

  7. Can I get bulk pricing for "MS4A4A Antibody - N-terminal region (ARP58497_P050)"?

    You can get bulk pricing for this item by going here.

  8. What is the molecular weight of the protein?

    The molecular weight reported by Uniprot for this item is "26kDa".
    Please note observed molecular weights in western blot applications may differ depending on a variety of protein characteristics.

  9. What protocols are available for "MS4A4A Antibody - N-terminal region (ARP58497_P050)"?

    We may have detailed protocol data avaialble for this item. To learn more, please view the "Protocols & Data" tab on the product page.

  10. What are positive controls for "MS4A4A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  11. What are negative controls for "MS4A4A"?

    We have listed RNA Seq and gene expression data in the "Target Info" tab. You may be able to find adequate positive controls there.

  12. What other proteins interact with "MS4A4A"?

    This protein has been reported to interact with "Protein Interactions". Please view the "Related Categories" tab on the product page for more information.

  13. What biological processes are associated with "MS4A4A"?

    This protein has been associated with "Biological Processes". Please view the "Related Categories" tab on the product page for more information.

  14. What cellular components are associated with "MS4A4A"?

    This protein has been associated with "Cellular Components". Please view the "Related Categories" tab on the product page for more information.

  15. What protein functions are associated with "MS4A4A"?

    This protein has been associated with "Protein Functions". Please view the "Related Categories" tab on the product page for more information.

Write Your Own Review
You're reviewing:MS4A4A Antibody - N-terminal region (ARP58497_P050)
Your Rating