Size:100 ul
Special Price $229.00 Regular Price $289.00
In Stock
SKU
ARP88721_P050
Request Bulk
Order Quote
Aviva's
Satisfaction
Guarantee
Contact Us:
  • Toll Free: (888)880-0001
  • Phone: (858)552-6979
  • Email: info@avivasysbio.com
Shipping Info:
  • $40: Antibody & Protein in US
  • $50: 1-2 Kits in US
  • Contact us for international orders.

MRVI1 Antibody - middle region (ARP88721_P050)

Catalog#: ARP88721_P050
Domestic: within 24 hours delivery | International: 3-5 business days
More Information
Tested Species ReactivityHuman
Predicted Species ReactivityHuman
Product FormatLiquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
ClonalityPolyclonal
HostRabbit
ApplicationWB
Reconstitution and StorageFor short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
ImmunogenThe immunogen is a synthetic peptide directed towards the middle region of human MRVI1
PurificationAffinity purified
Peptide SequenceSynthetic peptide located within the following region: LADRKQNDQRKVSQGRLAPRPPPVEKSKEIAIEQKENFDPLQYPETTPKG
ConcentrationBatch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking PeptideFor anti-MRVI1 (ARP88721_P050) antibody is Catalog # AAP88721
Datasheets/ManualsPrintable datasheet for anti-MRVI1 (ARP88721_P050) antibody
Gene SymbolMRVI1
Official Gene Full Namemurine retrovirus integration site 1 homolog
Alias SymbolsIRAG, JAW1L
NCBI Gene Id10335
Protein Nameprotein MRVI1
Description of TargetThis gene is similar to a putative mouse tumor suppressor gene (Mrvi1) that is frequently disrupted by mouse AIDS-related virus (MRV). The encoded protein, which is found in the membrane of the endoplasmic reticulum, is similar to Jaw1, a lymphoid-restricted protein whose expression is down-regulated during lymphoid differentiation. This protein is a substrate of cGMP-dependent kinase-1 (PKG1) that can function as a regulator of IP3-induced calcium release. Studies in mouse suggest that MRV integration at Mrvi1 induces myeloid leukemia by altering the expression of a gene important for myeloid cell growth and/or differentiation, and thus this gene may function as a myeloid leukemia tumor suppressor gene. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene, and alternative translation start sites, including a non-AUG (CUG) start site, are used.
Swissprot IdQ9Y6F6
Protein Accession #NP_001092049.2
Nucleotide Accession #NM_001098579.2
Protein Size (# AA)885
Molecular Weight97 kDa
Tissue ToolFind tissues and cell lines supported by DNA array analysis to express MRVI1.
RNA SeqFind tissues and cell lines supported by RNA-seq analysis to express MRVI1.
Write Your Own Review
You're reviewing:MRVI1 Antibody - middle region (ARP88721_P050)
Your Rating
Aviva Validation Data
Aviva Live Chat
Aviva Tips and Tricks
Aviva Tissue Tool