Search Antibody, Protein, and ELISA Kit Solutions

MRVI1 Antibody - middle region (ARP88721_P050)

100 ul
$289.00
In Stock
Request Bulk Order Quote

Gene Symbol:
MRVI1
Official Gene Full Name:
murine retrovirus integration site 1 homolog
NCBI Gene Id:
10335
Protein Name:
protein MRVI1
Swissprot Id:
Q9Y6F6
Protein Accession #:
NP_001092049.2
Nucleotide Accession #:
NM_001098579.2
Alias Symbols:
IRAG, JAW1L
Description of Target:
This gene is similar to a putative mouse tumor suppressor gene (Mrvi1) that is frequently disrupted by mouse AIDS-related virus (MRV). The encoded protein, which is found in the membrane of the endoplasmic reticulum, is similar to Jaw1, a lymphoid-restricted protein whose expression is down-regulated during lymphoid differentiation. This protein is a substrate of cGMP-dependent kinase-1 (PKG1) that can function as a regulator of IP3-induced calcium release. Studies in mouse suggest that MRV integration at Mrvi1 induces myeloid leukemia by altering the expression of a gene important for myeloid cell growth and/or differentiation, and thus this gene may function as a myeloid leukemia tumor suppressor gene. Several alternatively spliced transcript variants encoding different isoforms have been found for this gene, and alternative translation start sites, including a non-AUG (CUG) start site, are used.
Protein Size (# AA):
885
Molecular Weight:
97 kDa
Host:
Rabbit
Clonality:
Polyclonal
Purification:
Affinity purified
Application:
WB
Tissue Tool:
Find tissues and cell lines supported by DNA array analysis to express MRVI1.
RNA Seq:
Find tissues and cell lines supported by RNA-seq analysis to express MRVI1.
Immunogen:
The immunogen is a synthetic peptide directed towards the middle region of human MRVI1
Predicted Species Reactivity:
Human
Tested Species Reactivity:
Human
Peptide Sequence:
Synthetic peptide located within the following region: LADRKQNDQRKVSQGRLAPRPPPVEKSKEIAIEQKENFDPLQYPETTPKG
Product Format:
Liquid. Purified antibody supplied in 1x PBS buffer with 0.09% (w/v) sodium azide and 2% sucrose.
Reconstitution and Storage:
For short term use, store at 2-8C up to 1 week. For long term storage, store at -20C in small aliquots to prevent freeze-thaw cycles.
Concentration:
Batch dependent within range: 100 ul at 0.5 - 1 mg/ml
Blocking Peptide:
For anti-MRVI1 (ARP88721_P050) antibody is Catalog # AAP88721
Datasheets/Manuals:
Printable datasheet for anti-MRVI1 (ARP88721_P050) antibody

Product Reviews

Tell us what you think about this item!

Write A Review
    Please, wait...